RetrogeneDB ID:
retro_ecab_224
Organism:
Horse ( Equus_caballus )
Location:
10:78868130-78868566 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
51.63 %
Coverage:
58.75 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
HLF
Parental gene aliases:
No gene alias available
Parental gene description:
hepatic leukemia factor [Source:HGNC Symbol;Acc:4977]

Genomic region (view in browser)





>retro_ecab_224
CGTCATGACCATAGCCTCCACATTCCCGTAGCCAGCTGCCCAGCTGGCCCTTCTATCCTG
GCCCTGACATCTGGGCTCTACTCACCCAGCATCCTGTCGCAGAACCGTACACACAATCCC
ATCAGTCCAGGTCAGCTGCTGTCAGCAAACCACCAGACATGGGGCCCATGGATCCTGACA
AGATGCAGGTCCCAGTGGGGTACGAGCCAGTTGGGGGAGACCTTGCTCTCTCCAGCATCC
ATGCCCACAAAATATTTGATTCTAGTAAACCCAAGTTCTCTAAGTTTGAACTGAAAGCAT
AGTCCATGATTAGGAAATCTCACACAGTCTTCATACCTGGCTGTTGAAATTTAACAAGTA
CTGAGCTATGATTAGAAAGAACAACACAGCAGCCAAGTGCTCTTGAGATGCCTGAAGGCT
GAGGGAGAAAGAGATT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QHDHSPHPPGLQPASSAAPSVMDLSSRASAPIHPGIPSPNCMQSPIRPGQLLPANRNT-PSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFS
.HDHS.H.P.......A.PS...L....S....P.I.S.N....PI.PGQLL.AN..T...P.DPD..QVPVGYEP...DLALSSI.....FD..K.KFS
Retrocopy
RHDHSLHIP--VASCPAGPSILALT---SGLYSPSILSQNRTHNPISPGQLLSANHQT/MGPMDPDKMQVPVGYEPVGGDLALSSIHAHKIFDSSKPKFS


Parental protein
EEELKPQPMIKKARKVFIPDD-LKDDKYWARRRKNNMAAKRSRDARRLKENQI
..ELK...MI.K...VFIP...LK..KY.A..RKNN.AAK.S.DA.RL.E..I
Retrocopy
KFELKA*SMIRKSHTVFIPGC/LKFNKY*AMIRKNNTAAKCS*DA*RLREKEI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide