RetrogeneDB ID:
retro_ecab_225
Organism:
Horse ( Equus_caballus )
Location:
10:1076119-1076641 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.3 %
Coverage:
52.25 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
G3PDH
Parental gene aliases:
GAPDH, G3PDH
Parental gene description:
glyceraldehyde-3-phosphate dehydrogenase [Source:RefSeq peptide;Acc:NP_001157328]

Genomic region (view in browser)





>retro_ecab_225
GCTAACGTCATCCTTGACAACTTTGGCATCGTGGAGGGACACATGGCCACAGTCTATGCC
ATCACTGCCACACAGAAGACCATGAACAGTCCCTCTGGGAAGCTGTGGCATGATGCCTGA
GGGGCTGCCCACAACATCATCCCTGCTTCTACTGGTGCTGCCAAGGCTGTGGGCTAGGTC
ATCCCTGAGCTGAATGGAAAGCTTCCTGGCATGGCCTTCTGTGTCCCCAGCCCTGATGAG
TTGGCCATGCATCTGACCTGCCATCTACAAAAAGCTGTAAAATATGATGACATCAAGAAG
GTGGTGAAGTGGGCATCAGAAGGCCTCCTAAAGGGCATCCTGGGCTATGCTGAGGACAGG
TTATCTCCTGTGACTTTAACAGTGACACCCACTCTTCCACCTTCGGTCCTGGGGCTGGCA
TTACCCTCAGCAACCACTTGGTGAAGGTCTTTTCCTGGTATGACAGTGAATTTGACTATA
GCAACGGGGTGGTAGCTGTTAATGGTCCACATGGCCTCCAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.15
SRP021940_embryo 0.12
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.08
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AKVIHDHFGIVEGLMTTVHAITATQKTVDGPSGKMWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKAAKYDEIKK
A.VI.D.FGIVEG.M.TV.AITATQKT...PSGK.W.D..GAA.NIIPASTGAAKAVG.VIPELNGKL.GMAF.VP.P......LTC.L.KA.KYD.IKK
Retrocopy
ANVILDNFGIVEGHMATVYAITATQKTMNSPSGKLWHDA*GAAHNIIPASTGAAKAVG*VIPELNGKLPGMAFCVPSPDELAMHLTCHLQKAVKYDDIKK


Parental protein
VVKQASEGPLKGILGYTED-QVVSCDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVD-LMAHMASK
VVK.ASEG.LKGILGY.ED.QV.SCDFNSDTHSSTF..GAGI.L..H.VK..SWYD.EF.YSN.VV..LM.HMASK
Retrocopy
VVKWASEGLLKGILGYAED/QVISCDFNSDTHSSTFGPGAGITLSNHLVKVFSWYDSEFDYSNGVVA\LMVHMASK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide