RetrogeneDB ID:
retro_ecab_226
Organism:
Horse ( Equus_caballus )
Location:
10:4078645-4079438 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
94.72 %
Coverage:
50.38 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
ADCK4
Parental gene aliases:
No gene alias available
Parental gene description:
aarF domain containing kinase 4 [Source:HGNC Symbol;Acc:19041]

Genomic region (view in browser)





>retro_ecab_226
ATGTGGCTGGAGGTAGGGGGCCTCCTGCGGGGGACCTGTGGACAGCTGGGTCGGACTGGT
GGTCTGCCTTGTGGGGCCCCGAGGCCTGGGCCCCACTGGTGGGGGCCATGTGGGGGTTCT
TGGGCCCAAAAGCTTCATCAGGATGGGCCCGGCAGAGGTGTGGGTGAGGAAGACATCCGC
CGGGCACGGGAGGCCCAGATCAGGAAGACACCCCGGCCCCAGCTGAGTGACCGCTCTGGA
GAACGCAAGGTGCCCGCCTCCCGCATCAGCCGCTTGGCCAACTTTGGGGGACTGGGCTGT
GGGCTTGGGACTGGGAGCGCTGGCTGAGGTGGCTAAGAAGTCCCTGCCAGGAGGACATCG
ACAATCAGAAGGCAGCTCCCGGCCAGGCTCCAGCCCGTTGCTGTCGGAGGCCAACGCCGA
GCGGGTTGTGCAGACCTTGTGTACAGTTCGAGGGGCCGCCCTCAAGGTTGGCCAAATGCT
CAGCATCCAGGACAACAGCTTCATCAGCCCCCAGCTGCAGCGCATCTCCGAGCGGGTCTG
CCAGAGCGCCGACTTCATGCCCCGCTGGCAGATGCTGAGAGTTCTCGAGGAGGAGCTCGG
CACAGACTGGCAGGCCAAGGTGGCCTTTTTGGAGGAGGTGCCCTTTGCTGCTGTCTCAAT
TGGGCAGGTGCACCAGGGCCTGCTGAGGGACGGGACAGAGGTTGCCATGAAGATCCAGTA
CCCAGGCGTTGCCCAGAGCATTCAGAGCAATGTGCAGAACCTGCTGGCGGTGCTCAAGAT
GGGCGTGGCCCTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MWLEVGGLLRGTCGQLGRTVGLPCGAPRPGPHWWGPCGGSWAQKLHQDGPGRGLGEEDIRRAREARIRKTPRPQLSDRSRERKVPASRISRLANFGGL-A
MWLEVGGLLRGTCGQLGRT.GLPCGAPRPGPHWWGPCGGSWAQKLHQDGPGRG.GEEDIRRAREA.IRKTPRPQLSDRS.ERKVPASRISRLANFGGL.A
Retrocopy
MWLEVGGLLRGTCGQLGRTGGLPCGAPRPGPHWWGPCGGSWAQKLHQDGPGRGVGEEDIRRAREAQIRKTPRPQLSDRSGERKVPASRISRLANFGGL\A


Parental protein
VGLGLGALAEVAKKSLPGGHRQSEGSSRPGSSPLLTEANAERVVQTLCTVRGAALKIGQMLSIQDNSFISPQLQRIFERVRQSADFMPRWQMLRVLEEEL
VGLGLGALAEVAKKSLPGGHRQSEGSSRPGSSPLL.EANAERVVQTLCTVRGAALK.GQMLSIQDNSFISPQLQRI.ERV.QSADFMPRWQMLRVLEEEL
Retrocopy
VGLGLGALAEVAKKSLPGGHRQSEGSSRPGSSPLLSEANAERVVQTLCTVRGAALKVGQMLSIQDNSFISPQLQRISERVCQSADFMPRWQMLRVLEEEL


Parental protein
GTDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQYPGVAQSIQSDVQNLLAVLKMSVAL
GTDWQAKVA.LEEVPFAA.SIGQVHQGLLRDGTEVA.KIQYPGVAQSIQS.VQNLLAVLKM.VAL
Retrocopy
GTDWQAKVAFLEEVPFAAVSIGQVHQGLLRDGTEVAMKIQYPGVAQSIQSNVQNLLAVLKMGVAL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide