RetrogeneDB ID:
retro_ecab_227
Organism:
Horse ( Equus_caballus )
Location:
10:5535542-5535883 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.59 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RPL30
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L30 [Source:HGNC Symbol;Acc:10333]

Genomic region (view in browser)





>retro_ecab_227
ATGGTGGCAGCAAAGAAGAAGAATTAGTCACTTGAGTCAATCAACTCTAGGCTCCAATTC
ATTATGAAAAGTGGAAAATACTGCTGGGGTACAAGTGGACTCTGAAAATGATCAGACAAG
GCAAAGCAAAACTGGTCATCCTCGACATCTGCCCAGCCTTGAGGAAATCTGAAATAGAGT
ATTATGCCATGTTGGCCAAAACTAGTGTCCATCACTACAGTGTCAATAATTTATTGAATT
GGGCACAGCATGTAGAAATTACTAGAGAATGCACACTGGCTATCATTGATCCAGGTGATT
CTGATATTGTTAGAAGCATGCCAGAACAGACTGGTGAAAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.2
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVAAKKTKKSLESINSRLQLVMKSGKY-VLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDP
MVAAKK...SLESINSRLQ..MKSGKY..LGYK.TLKMIRQGKAKLVIL...CPALRKSEIEYYAMLAKT.VHHYS.NN...........R.CTLAIIDP
Retrocopy
MVAAKKKN*SLESINSRLQFIMKSGKY/LLGYKWTLKMIRQGKAKLVIL-DICPALRKSEIEYYAMLAKTSVHHYSVNNLLNWAQHVEITRECTLAIIDP


Parental protein
GDSDIIRSMPEQTGEK
GDSDI.RSMPEQTGEK
Retrocopy
GDSDIVRSMPEQTGEK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide