RetrogeneDB ID:
retro_ecab_228
Organism:
Horse ( Equus_caballus )
Location:
10:8020861-8021434 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
82.29 %
Coverage:
71.0 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_ecab_228
ACGAAGGTTTTGGTAACAGTAAAATGGTTCAAGGTAAGAAACGGATCTGGTTTCATCAAC
AGGAATGACACCAAGGAAGACGTATTTGTGTACCAGACTGCCATGAAGAAGAATCATCCC
AGGAAGTACCTTCACAGTGTAGGAGACAGAGAGACTGTGGAGTTTGATGTTGGTGAAGGA
GAAAAGGGTGCGGAGGCAGCAAATGTTACAGGTCCTGGTGGAGTTCCAGTGCAAGGAAGT
AAATACACAGCAGACTGTAACCATTACAGATGCTATCCACGCGGCAGGGATCCTCCACGC
AACTGCCAGCAGAATTACCAGAAGAGTGAGAGTGGAGAAAAGAACGAGGGATCGGAGAGT
GCTCTCAAAGGTCAGGCCCAACAGCGCCGGCCCTACCACAGGCGACAACGGCTCCCATCT
TACTACATGCGGAGTCCCTGTGGGCGTCAACCACAGTATTCCAATCCTCCTGTGCAAGAA
GTGATGGAGGGTGCTGACAACCAGAGTGCAGGAGAACAAGGCAGACCAGTGAGGTAGAAT
AGGTATTGGGGTTATACACTAGGATTCTGCAGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.39
SRP021940_cerebellum 0.2
SRP021940_embryo 0.31
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 1.28
SRP021940_testis 0.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPR
TKVL.TVKWF.VRNG.GFINRNDTKEDVFV.QTA.KKN.PRKYL.SVGD.ETVEFDV.EGEKGAEAANVTGPGGVPVQGSKY.AD.NHYR.YPR.R.PPR
Retrocopy
TKVLVTVKWFKVRNGSGFINRNDTKEDVFVYQTAMKKNHPRKYLHSVGDRETVEFDVGEGEKGAEAANVTGPGGVPVQGSKYTADCNHYRCYPRGRDPPR


Parental protein
NYQQNYQNSESGEKNEGSESAPEGQAQQRRPY-RRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRR
N.QQNYQ.SESGEKNEGSESA..GQAQQRRPY.RR.R.P.YYMR.P.GR.PQYSNPPVQ.EVMEGADNQ.AGEQGRPVR.N.Y.GY...F.R
Retrocopy
NCQQNYQKSESGEKNEGSESALKGQAQQRRPYHRRQRLPSYYMRSPCGRQPQYSNPPVQ-EVMEGADNQSAGEQGRPVR*NRYWGYTLGFCR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide