RetrogeneDB ID:
retro_ecab_231
Organism:
Horse ( Equus_caballus )
Location:
10:13097454-13097898 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
80.0 %
Coverage:
95.48 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
FUNDC1
Parental gene aliases:
No gene alias available
Parental gene description:
FUN14 domain containing 1 [Source:HGNC Symbol;Acc:28746]

Genomic region (view in browser)





>retro_ecab_231
CCTGAAGAACATGAAACTGATGATGACTCTTCTGAAATGTTGGACTTAAGTGAGTAGGCA
AGAAGACACCATTGGTGGAATCGAGTGTTTGTCTATAATTTCAAACCTATGGTAGAAAAA
ATACTCAGTAGCCACTCAGATTATTATGGGTGGAGTGACTGACTGGTGTGTGGGGTTTTT
GTTCCAGAAGGTTGAAAAGCTTGCAGCAACTGCAGTAGACGGTGGCTTTCTTCTCATTCA
GATTGCCAGTCTCAGTGGCTATGTGCAGATCGACTGGAAGAGAGGTGAAAAAGATGTAAA
CAAAGCAAAAAGACATTTAAGAAATGAGCAAATAAAGCAGCACCAGAATTCAACAAGATA
ATTGAAGAAGCAACAGAATTTGTTAAACAAAACATTGTGATATCCAGTGGATTTGTGGTA
GGCTTTTGGCTAGGACTTACATCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.07
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PQEYESDDDSYEVLDLTEYARRHHWWNRVFGHSSGPMVEK-YSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDV
P.E.E.DDDS.E.LDL.E.ARRHHWWNRVF.....PMVEK.YSVATQI.MGGVT.WC.GFLFQKV.KLAATAV.GGFLL.QIAS.SGYVQIDWKR.EKDV
Retrocopy
PEEHETDDDSSEMLDLSE*ARRHHWWNRVFVYNFKPMVEK\YSVATQIIMGGVTDWCVGFLFQKVEKLAATAVDGGFLLIQIASLSGYVQIDWKRGEKDV


Parental protein
NKAKRQI-KKRANKAAPEINNIIEEATEFVKQNIVISSGFVGGFLLGLAS
NKAKR...KK.ANKAAPE.N.IIEEATEFVKQNIVISSGFV.GF.LGL.S
Retrocopy
NKAKRHL/KK*ANKAAPEFNKIIEEATEFVKQNIVISSGFVVGFWLGLTS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide