RetrogeneDB ID:
retro_ecab_232
Organism:
Horse ( Equus_caballus )
Location:
10:16587153-16587756 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
63.46 %
Coverage:
95.77 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
EBAG9
Parental gene aliases:
No gene alias available
Parental gene description:
estrogen receptor binding site associated, antigen, 9 [Source:HGNC Symbol;Acc:3123]

Genomic region (view in browser)





>retro_ecab_232
CAGTTTCAGCTACTTGAAGTCTGTGTGTGCCCAGCAACAGTATTGTCACTCCTAAAGGGA
TTAATATGCAGATCTAACAGAGGATGGAAATTAAGTCGAGATCAAATAACTTTGCCAACT
ACAGTTGATTGTTCAAAGTTCCTGGGCAGATGGGCGTTGAAGATGGACCTCCTGGGAGGA
AGATGCACCCACACGTGTAAAGACGGAAGGAGGGACTGGGAAAGTGGCCACACTATGAAA
AACAGCGGGAAACACAAAGGAACCCGACAATTTTAAGGACATGATAACAACTAGAAGGAA
AACTGAGAAAATCAGTATCGAGAAGAGCGAACTATTAAATTTTCACCAGTCAGTTGGGAG
CACAGTTTTCTCTAGTAAATTAGCAACTACACAGGATGTTCCTTTTATGCATCTATCTCC
AGAATTAGGTGACAGAGAGGCCTGGCAAGAAAATACCAGTGCACGGGAAGAAGGTATGGC
CTGGCGAGCAGAAGCTCTGTAGCAGCAGAAAACAGCAGACGGAGAACAAAGAACCGCAGA
AAACAAAGGAAGAAAATGGAAAAGGAAGCACGGGGAGGACAGAAGAAGGAACAATGGAAA
CTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.3
SRP021940_embryo 0.12
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QFRLFKVCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSS-VPKQTDVEE-WTSWDEDAPTSVKIEGGNGNVATQ-QNALEQLEPDYFKDMTPT
QF.L..VC.C.ATV.S.LK.LICRS.RG.KLS.DQITLPTTVD.S..VP.Q..VE..WTSW.EDAPT.VK.EGG.G.VAT....A....EPD.FKDM..T
Retrocopy
QFQLLEVCVCPATVLSLLKGLICRSNRGWKLSRDQITLPTTVDCSK/VPGQMGVED/WTSWEEDAPTRVKTEGGTGKVATL*KTAGNTKEPDNFKDMITT


Parental protein
IRKTQKIIIKKREPLNFGIPDGSTGFSSRLAATQDMPFIHQSPELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKIADREKRAAE-QQRKKMEKEAQRL
.RKT.KI.I.K.E.LNF....GST.FSS.LA.TQD.PF.H.SPELGD...WQENT.A...EE..AW.A.E.L.QQK.AD.E.R.AE..QRKKMEKEA...
Retrocopy
RRKTEKISIEKSELLNFHQSVGSTVFSSKLATTQDVPFMHLSPELGDREAWQENTSA--REEGMAWRA-EAL*QQKTADGEQRTAE/KQRKKMEKEARGG


Parental protein
MKKEQNKI
.KKEQ.K.
Retrocopy
QKKEQWKL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide