RetrogeneDB ID:
retro_ecab_233
Organism:
Horse ( Equus_caballus )
Location:
10:19935032-19936795 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.56 %
Coverage:
100.0 %
Frameshifts:
7
Stop codons:
2


Parental gene:
Parental gene symbol:
PPP2R1B
Parental gene aliases:
No gene alias available
Parental gene description:
protein phosphatase 2, regulatory subunit A, beta [Source:HGNC Symbol;Acc:9303]

Genomic region (view in browser)





>retro_ecab_233
GGCCGAGATGGAGACGAGTCGCTATATCTGATCGCGGTTTAATCGACGAGCTGCGCAATG
AGGACGTGCAGCCCCGTCTCAACAGTATTAAGAAGTTATCCACAATTGCTCTAGCACTTG
GAGTAGAAAGGACGCGAACTAACTGCTGCCATTCCTTACAGACACAATTTATGATGAAGA
TGAGGCACCGTTAGCTGTTGCAGAGCAGCTGGGAAATTTCACCGGCCTGCTGGGAGGTCC
TGACTTTGCCCACTGTTTGCTGCCTCCTTTGGAAAGCCTGGCGACGGTGGAAGAGACTGT
GTTTCGCGACAAGGCGGTGGAGTCCCCGAGGTAGATCTCCCAGGAGCATACTCCTGTGGC
TCTGGAAGCTCGTTTTGCACCTCTGGTGAAACGCCTGGGCGAGTGGCTATTGGTTCACTT
CTTGCACATCTGCCTGTGGTTTGTTCAGCGTTTGCTATCCCAGGGCTTCAAATGCTCTCA
AAGCAGAAATTAGACAATACTTTTTCATTCCTTGTGCTCAGATGACACACCAATGGTACG
ACGTGCTGCTGCTTCCAAGTTGGGTGAATTTGCAAAAGTTTTGGAATTAGACAGTGTGAA
AAGTGAAATTGTTCCGTTGTTGACTCGTCTAGCTTCAGATGAACAGGATTCGGTGCGCCT
CCTAGCTGTGGAAGCTTGTGTCAGTATTGCCCAGTTACTGTCTCAGGACGACCTTGAGGC
TTTGGGGATGCCCACCCTTTGACAAGCAGCGGAAGATAAATCCTGGCGAGTTCGCTATAT
GGTAGCTGACAAATTTTCAGAGCTCCAGAAAGCTGTGGGTCCTAAAATCACCGTAAATGA
CCTCATCCCCGCCTTTCAGAACCTACTTCAAGACTGCGAAGCTGAGGTCCGAGCAGCTGC
TGCCCACAAAGTCAGAGAACTTTGTGAGAACTTGCCCATTGAAGGCAGAGAGACCATCAT
TACGAATCAAATTCTGCCCTATAGAAAGGAATTAGTGTGTGATACAAATCAAGATGTCAA
ATCAGCTCTAGCTTCTGTAATTATGGGATTGTCTACAATTTTGGGCAAAGAGAATACCAT
TGAACATCTTTTACCTCTTTTTTTTAGCTCAGTTAAAGGATGAGTGTCCTGAAGTTTGTT
TGAATATCATCTCCAATTTAGACTGTGTAAATGAAGTGATTGGCAACCGTCAGCTCTCTC
AGTCTCTCCTTCCTGCCATCGTGGAGCTGGCTGAAGATGCCAAGTGGAGGGTCCGGCTGG
CCATCATTGAGTACATGCCTCTGCTGGTGGGCCAGCTGGGCATGGAATTCTTTGAGGAAA
AGCTGAATTCTTTATGTATGGCCTGGCTTATGGACCATGTATATGCCATCCGTGAAGCCG
CCACCAGCAACCTCATGAAACTAGTTCAGAAGTTTGGTACAGAGTGGGCCCAAAATACCA
TTGTTCCCAAAGTGTTAGTAATGGCAAAATGATCCTAATTACTTACATAGAATGACTACT
TTATTCTGCATTAACGCACTGTCCGAAGCCTATGGTCGAGAAATAACCACTAAACAGATG
CTGCGCATCGTATTGAAAACAGCAGGAGACCAAGTAGCGAATGTCCGTTTCAATGTGCCA
AATCTCTACAGAAAATTGGAACAATTCTAGATACCGAGGCTTTGCAGGAGGAAGTTAAGC
CGGTGCTACAGAAGTTAGGCCAAGATGAAGACATGGATGTCAAATACTTCATACAGGAAG
CAATAAGTGCGCTTGCGTTGGCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.15
SRP021940_embryo 0.29
SRP021940_placental_villous 0.22
SRP021940_synovial_membrane 0.13
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GGDGDDSLYPIAV-LIDELRNEDVQLRLNSIKKLSTIALALGVERTRTE-LLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLESLATVE
G.DGD.SLY.IAV.LIDELRNEDVQ.RLNSIKKLSTIALALGVERTRT..LLPFLTDTIYDEDE..LA.AEQLGNFTGL.GGPDFAHCLLPPLESLATVE
Retrocopy
GRDGDESLYLIAV/LIDELRNEDVQPRLNSIKKLSTIALALGVERTRTN/LLPFLTDTIYDEDEAPLAVAEQLGNFTGLLGGPDFAHCLLPPLESLATVE


Parental protein
ETVVRDKAVESLRQISQEHTPVALEAHFVPLVKRL-ASGDWFTSRTSACGLFSVCYPRASNALKAEIRQCFRSLCT-DDTPMVRRAAA-SKLGEFAKVLE
ETV.RDKAVES.R.ISQEHTPVALEA.F.PLVKRL.ASG.WFTS.TSACGLFSVCYPRASNALKAEIRQ.F...C...D.....R.AA.SKLGEFAKVLE
Retrocopy
ETVFRDKAVESPR*ISQEHTPVALEARFAPLVKRL\ASGYWFTSCTSACGLFSVCYPRASNALKAEIRQYFFIPCA/SDDTPMVRRAAASKLGEFAKVLE


Parental protein
LDSVKSEIVPLFTNLASDEQDSVRLLAVEACVSIAQLLSQDDLEALVMPTLRQAAEDKSWRVRYMVADKFSELQKAVGPKITLSDLIPAFQNLLKDCEAE
LDSVKSEIVPL.T.LASDEQDSVRLLAVEACVSIAQLLSQDDLEAL.MPTL.QAAEDKSWRVRYMVADKFSELQKAVGPKIT..DLIPAFQNLL.DCEAE
Retrocopy
LDSVKSEIVPLLTRLASDEQDSVRLLAVEACVSIAQLLSQDDLEALGMPTL*QAAEDKSWRVRYMVADKFSELQKAVGPKITVNDLIPAFQNLLQDCEAE


Parental protein
VRAAAAHKVKELCENLPIEGGQGMHGTDMLIYDIELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLP-LFLAQLKDECPEVRLNIISNLDCVNEVIG
VRAAAAHKV.ELCENLPIEG.........L.Y..ELV.DTNQ.VKSALASVIMGLSTILGKENTIEHLLP....AQLKDECPEV.LNIISNLDCVNEVIG
Retrocopy
VRAAAAHKVRELCENLPIEGRETIITNQILPYRKELVCDTNQDVKSALASVIMGLSTILGKENTIEHLLP\XXXAQLKDECPEVCLNIISNLDCVNEVIG


Parental protein
IRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLMKLVQKFGTEWAQNTIVPKVLVMA-NDPNY
.RQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLL.GQLG.EFF.EKLNSLCMAWL.DHVYAIREAATSNLMKLVQKFGTEWAQNTIVPKVLVMA.NDPNY
Retrocopy
NRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLVGQLGMEFFEEKLNSLCMAWLMDHVYAIREAATSNLMKLVQKFGTEWAQNTIVPKVLVMA\NDPNY


Parental protein
LHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNV-AKSLQKIGPILDTEALQEEVKPVLQKLGQDEDMDVKYFAQEAISVLALA
LHRMTTLFCINALSEA.G.EITTKQML.IVLK.AGDQVANVRFNV.AKSLQKIG.ILDTEALQEEVKPVLQKLGQDEDMDVKYF.QEAIS.LALA
Retrocopy
LHRMTTLFCINALSEAYGREITTKQMLRIVLKTAGDQVANVRFNV/AKSLQKIGTILDTEALQEEVKPVLQKLGQDEDMDVKYFIQEAISALALA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide