RetrogeneDB ID:
retro_ecab_234
Organism:
Horse ( Equus_caballus )
Location:
10:25355750-25356356 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
65.22 %
Coverage:
68.69 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
SLC25A36
Parental gene aliases:
No gene alias available
Parental gene description:
solute carrier family 25 (pyrimidine nucleotide carrier ), member 36 [Source:HGNC Symbol;Acc:25554]

Genomic region (view in browser)





>retro_ecab_234
GCCATTCGCACACATCCACTGGAAGGTGTAATAACACATCTGTGGTCTTCTGTTGTGATG
CTTTCTATCTCTGAAGTTTAGCTGAACATCATAGCTAGAGCTAGTGTCAACTGGACCAGC
CTCTCCTGGATCTTTCCACTGCCTGAAGGTGACCTTGGGAAAAGCAGTCTTCTTCCTTGT
TTAAGAGGATTAGGCTCCAGTTTATTGGGGATTGCCTCTTCCAGAACATTCTTTGCCGCT
TATTCAAACTGCAAGGAAAAGTTGAATGGTGTATTTGATCCTGATTCTGCCCCATGCATG
GTTTTGGCTGCAGTGGCTTATTTTACTACAATCACAGCAACCAATCCCATTTGGCTACTA
AAGAGTTGGTTACAGCCTGATGCAAGGAACCATGGGAAAAAGCAAATGGGTGCTTTTGAA
TGTGCTCATGAAGTGTATTAGACAGATGACCCAAGAGGACTTTATAGGGGCATGTCTGCT
TCATATGGTAGCATATCAGGGACTGTTATTCATTTGGTTATTTGTGAAAATATTAAGCAG
AAACTACTGGAATAAAAGATTACTTCGATGATGGAAGATGATAAGGAGTCTGTGAAAGAA
GCATCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.07
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AILTCPLEVVKTRLQSSSVTLYISEVQLSTMAGASVNRV-VSPGPLHCLKVIL-EKEGPRSLF-RGLGPNLVGVAPSRAIYFAAYSNCKEKLNGVFDPDS
AI.T.PLE.V.T.L.SS.V.L.ISEV.L...A.ASVN....SPG..HCLKV.L.EK....SLF.RGLG..L.G.A.SR...FAAYSNCKEKLNGVFDPDS
Retrocopy
AIRTHPLEGVITHLWSSVVMLSISEV*LNIIARASVNWT\ASPGSFHCLKVTL\EKQSS-SLF\RGLGSSLLGIASSRT-FFAAYSNCKEKLNGVFDPDS


Parental protein
TQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGEKRMGAFECVRKVYQTDGLRGFYRGMSASYAGISETVIHFVIYESIKQKLLDYKAPSTVENDE
....M..AA.A.FT.ITATNPIWL.K..LQ.DARN.G.K.MGAFEC...VY.TD..RG.YRGMSASY..IS.TVIH.VI.E.IKQKLL..K..S..E.D.
Retrocopy
APC-MVLAAVAYFTTITATNPIWLLKSWLQPDARNHGKKQMGAFECAHEVY*TDDPRGLYRGMSASYGSISGTVIHLVICENIKQKLLE*KITSMMEDDK


Parental protein
ESVKEAS
ESVKEAS
Retrocopy
ESVKEAS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide