RetrogeneDB ID:
retro_ecab_235
Organism:
Horse ( Equus_caballus )
Location:
10:26985822-26986260 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.25 %
Coverage:
78.72 %
Frameshifts:
3
Stop codons:
3


Parental gene:
Parental gene symbol:
NDUFB5
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa [Source:HGNC Symbol;Acc:7700]

Genomic region (view in browser)





>retro_ecab_235
GCCATGAGTTTATCGCAGTGGGCTTTGGTCACTGTGGCAGCCAGAGTGGCCACCATCTTG
GGACTCAACTTAGATTCAGGGACGTCTTCACCCGCAGCCTTCTGAAGACTGTAGCTCCTG
TGTGACACAGTGGAGGCCACAGGAAAGGACTGTTTATCCTATCTTCTGGATTCTGTGATA
GTGTTTTTTGGAATTTAGTGAAACTCTATATTTTGTTGACTGGGATTGCAGTGGCATTGG
CATAACTCTGGTGAATGTATTCATTGGTGAAGCTGAGTTAGCAGAAATTCCAAAAGGCTA
TGTTCCAGGACACTGGGAATATTTCAACCATCCTCTATCAAGATGAACTTCCTGTACTTT
CTTTGATGTTCCTGGGAAGAATCATGAAAAAACAATGCCTATCCTTTAAATGAAGCCAAA
AAGGCTGAATTACAGTTA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.07
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AMSLLQRASVAAA-SLCGRRLGPRHAFGGFLTRGFPKTVAPVRHSGGHGKRLFIIKPSGFYDRRFLNLMRFYILLTGIPVA-IGITLINVFIGEAELAEI
AMSL.Q.A.V..A.S..G..LG....F....TR...KTVAPV.HSGGH.K.LFI...SGF.D..F.NL...YILLTGI.VA.IGITL.NVFIGEAELAEI
Retrocopy
AMSLSQWALVTVA/SQSGHHLGTQLRFRDVFTRSLLKTVAPV*HSGGHRKGLFILS-SGFCDSVFWNLVKLYILLTGIAVA/IGITLVNVFIGEAELAEI


Parental protein
PEGYIPEHWEYFKHPISRWIARTFFDSPEKNYEKTLAILQI-EAEKADLRL
P.GY.P.HWEYF.HP.SR....TFFD.P.KN.EKT..IL...EA.KA.L.L
Retrocopy
PKGYVPGHWEYFNHPLSR*TSCTFFDVPGKNHEKTMPIL*M/EAKKAELQL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide