RetrogeneDB ID:
retro_ecab_240
Organism:
Horse ( Equus_caballus )
Location:
10:47119603-47120471 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.41 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
LRRC59
Parental gene aliases:
No gene alias available
Parental gene description:
leucine rich repeat containing 59 [Source:HGNC Symbol;Acc:28817]

Genomic region (view in browser)





>retro_ecab_240
AAGCTGGACGGCAACGACCTGGACCTGAGCCTCAGCGACCCGAATGAGGTCCCCGTCAAG
GAGCTTGCCGCCTTCCCAAAGGCCACCCTACTGGATCTGTCCTGCAATAAAGTGATTACT
CTACCGTCGGATTTCTGTGGCCTCAGGCACCTTGTGAAGCTGGACCTCAGTAAGAACAAA
CTGCAGCAACTGTGGGCCGACTTCGGCCGTCTGGTCAACCTCCAGCACCTGGCTCTCCTC
AACAGGCTGCTCACCCTGTCTGTCAGATTTGCTCAGCTCAAGAGCCTGAAGTTGGCTGGA
CCTGAAGGATAACCCCCTGGATCCTGTCCTGGCCAAAGTGGCAGACGATTGCTTGGATGA
GAAGCAGTGTAAGCAGTGTGCCAGCAAGGCGTGACAGCACATGAAGGCCTTGCAGGCGAA
TCAGGGGCGAGAGAGGCTGCGGCGACTAGAAGTAGAACGAGAGAATGAGAGGAAGCGGGA
GGCCAGGCAGGGAGCTAAGGAAGCTCAGGAGCGGGAACTAGGGAAGCGGGAGAAGGCAGA
AGAGAAGGAGCACCGGAGAAAAGAGTATGATGCCTTCAAGGCAGCCAAGAGGGAGCGGGA
GAAGAAACCTAAGAAGGAAACAAATCAGGCCACGAAATCTAAGTCTGGCTCTCGCCCGCG
GAAGCCACCACCCCGGAAACACACCCGGTCCTGGGCTGTGCTGAAGCTGCTGCTGCTGTG
CGTGGCCGGTGGGCTGGTTGCTTGTCGGGTGACAGAGCTGCAGCAGCAGCCCCTCTGCAC
CAGCGTGAACACCATCTACGACAGTGCGGTCCGGGGTCTGCGCAGCCAAGACATCCTCCA
GTGGGTCCTGCAGACCGATTCTCAGCAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.75
SRP021940_cerebellum 0.65
SRP021940_embryo 1.05
SRP021940_placental_villous 0.58
SRP021940_synovial_membrane 0.76
SRP021940_testis 1.31

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KLDGNELDLSLSD-NEVP-KELAALPKATVLDLSCNKLTTLPSDFCGLTHLVKLDLSKNKLQQLPADFGRLVNLQHLDLLNNRLVTLPVSFAQLKSLK-W
KLDGN.LDLSLSD.NEVP.KELAA.PKAT.LDLSCNK..TLPSDFCGL.HLVKLDLSKNKLQQL.ADFGRLVNLQHL.LLN.RL.TL.V.FAQLKSLK.W
Retrocopy
KLDGNDLDLSLSDPNEVPVKELAAFPKATLLDLSCNKVITLPSDFCGLRHLVKLDLSKNKLQQLWADFGRLVNLQHLALLN-RLLTLSVRFAQLKSLK\W


Parental protein
LDLKDNPLDPVLAKVAGDCLDEKQCKQCASKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQRAKEAQEREVRKREKAEEKERRRKEYDALKAAKRE
LDLKDNPLDPVLAKVA.DCLDEKQCKQCASK..QHMKA.QA.Q.RER.RRLEVERE.E.KREA.Q.AKEAQERE..KREKAEEKE.RRKEYDA.KAAKRE
Retrocopy
LDLKDNPLDPVLAKVADDCLDEKQCKQCASKA*QHMKALQANQGRERLRRLEVERENERKREARQGAKEAQERELGKREKAEEKEHRRKEYDAFKAAKRE


Parental protein
QEKKPKKETNQATKSKSGSRPRKPPPRKHTRSWAVLKLLLLLLLCVAGGLVACRVTELQQQPLCTSVNTIYDNAVRGLRSHNILQWVLQTDSQQ
.EKKPKKETNQATKSKSGSRPRKPPPRKHTRSWAVLKLLLL...CVAGGLVACRVTELQQQPLCTSVNTIYD.AVRGLRS..ILQWVLQTDSQQ
Retrocopy
REKKPKKETNQATKSKSGSRPRKPPPRKHTRSWAVLKLLLL---CVAGGLVACRVTELQQQPLCTSVNTIYDSAVRGLRSQDILQWVLQTDSQQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide