RetrogeneDB ID:
retro_ecab_242
Organism:
Horse ( Equus_caballus )
Location:
10:53576500-53577434 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.24 %
Coverage:
56.91 %
Frameshifts:
7
Stop codons:
6


Parental gene:
Parental gene symbol:
ZP4
Parental gene aliases:
No gene alias available
Parental gene description:
zona pellucida glycoprotein 4 [Source:HGNC Symbol;Acc:15770]

Genomic region (view in browser)





>retro_ecab_242
GTGATGGCAACACACACCTTTGCCCCTTTCCAGTTTCCATTTACTTCCTGTGGTACCACA
AGACAGATCACTGGAGACTAGGCAGTGTATGAAAATGAGCTAGTTGCGGCTAGGGAGGTG
AGAACTTGGGGCCATGGTTTTATCACCTTCAACAGTATCCTCAGGGTTAGAGTCAGCTGC
AGCTTCTCTGGTAAATAGCAACGCATCCCTGGTTTAATATCGTGGTTCTTACTCTCTCAA
TCACTCCTTTTCTGAGACCCAGCCCGGACCCCTCACTCCGGGAACCTCAGGATTGCCAGG
AGATAAAAAACCTATGGCTCCTACTACACTGTTGGTGACTACCCAGTGGTGAAGTTATTC
AGGACCCCTTTCATGTGGATTTCTCCATTCATCACAGAACAGACCCCTACCGAGGGCTGC
TTCTATGTCAGTGTTGGGCCATGCCCAGCACAACCCCCTGCATCAGTCACGGTGGCCTAC
GCTGGTTAAGGGGATGCTCCTAGACTGGAGATAATTATCAGACCCAACTGATCCCTGTTC
AGAAAGCCTTGGATCTGCCATTTCCTTCTCCCTACCAGTGCTTTAACTTTTTCACCTTCA
GCTTTGAGGACTCCATGGCAAAGTGGGCACTCAGGAGACTGGTGTATCTGCACTGCTGTC
CATCAGTCTGCCAGCCTACTGGGACATCATCCTATATGATAACCTTTCCTGTTGCCAGGT
GAAGAAGAAGCTCTGACATCCATTGTCAGAACAGTCCTGTAAGCATTTCTAGAAGAGTCC
CATGATTCTAATCCAAGTCACTAAGGACTCTTTAGAAAAACTCTAGAATTACTCAAGCTC
TCCTGTAGACTCCCAAGCTCTGTGAGTGGCAGGCCTTTCTGGGACCTTAATAGTTGGAGA
CTTGTTAGTATCTTACTTGGCTATCAGGAAACAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VMATHAFALFRFPFSSCGTTRRVTGDQAVYENELVATRDVRTWSHGSITRDSIFRFQVSCSYS-VSSNAFPV-NVQVFTLP-PPLPETQPGPLTLE-LRI
VMATH.FA.F.FPF.SCGTTR..TGD.AVYENELVA.R.VRTW.HG.IT..SI.R..VSCS.S.V.SNA..V.N..V.TL...P.....P.P...E.LRI
Retrocopy
VMATHTFAPFQFPFTSCGTTRQITGD*AVYENELVAAREVRTWGHGFITFNSILRVRVSCSFS\VNSNASLV\NIVVLTLSITPFLRPSPDPSLRE\LRI


Parental protein
AKD-KHYISYYNVSDYPVVKL-LQDPIYVEVSILHRTDPYLGLMLHQCWATPST-NPLHQPQWPLLVKG-CPYTGDSYQTQLIPVQKALDLPFPSHYQRF
A...K.Y.SYY.V.DYPVVKL..QDP..V..SI.HRTDPY.GL.L.QCWA.PST.NPLHQ..WP.LVKG.C..TGD.YQTQLIPVQKALDLPFPS.YQ.F
Retrocopy
ARR*KTYGSYYTVGDYPVVKL/IQDPFHVDFSIHHRTDPYRGLLLCQCWAMPST/NPLHQSRWPTLVKG\CS*TGDNYQTQLIPVQKALDLPFPSPYQCF


Parental protein
SIFTFSFVDSVAKRAFKGLVYLHCSASVCQPAGTPPCMITCPVTRRRRSSDIRFQNSTASISS-KGPMILLQATKDSSEKLHKYSTSPVDSQSLWVAGLS
..FTFSF.DS.AK.A...LVYLHC..SVCQP.GT...MIT.PV.R.RRSSDI..QNS..SIS..K.PMIL.Q.TKDS.EKL..YS.SPVDSQ.L.VAGLS
Retrocopy
NFFTFSFEDSMAKWALRRLVYLHCCPSVCQPTGTSSYMITFPVAR*RRSSDIHCQNSPVSISR/KSPMILIQVTKDSLEKL*NYSSSPVDSQAL*VAGLS


Parental protein
GTFIVGASLVSYLAIRKQ
GT.IVG..LVSYLAIRKQ
Retrocopy
GTLIVGDLLVSYLAIRKQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide