RetrogeneDB ID:
retro_ecab_246
Organism:
Horse ( Equus_caballus )
Location:
10:67283170-67283684 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
90.17 %
Coverage:
73.39 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
ANP32B
Parental gene aliases:
No gene alias available
Parental gene description:
acidic (leucine-rich) nuclear phosphoprotein 32 family, member B [Source:HGNC Symbol;Acc:16677]

Genomic region (view in browser)





>retro_ecab_246
GTTCGAGAACTTGTCCTGGACAATTGCAAATCAAACGATGGGAAAATTGAGGGCTTAACA
GCTGAATTTGTGAAAGAGTTCCTCAGTCTAATAAATGTAGGCTTGATTTTCAGTTTCAAA
TCTCCCCAAACTACCTAAATTGAAAAAGCTTGAGCTCAGTGACAATAGAATCTTTGGAGG
TCTGGACGTGTTAGCAGAAAAACTTCCAAATCTCACACATCTAAACTTAAGTGGAAATAA
ACTGAGAGGCATCGGCACCTTGGAACCTCTGAAAAAGTTGGACTGTCTGAAAAGCCTGGA
TCTGTTTAACGGTGAGGTTACGAACCTGAATGACTACCGAGAGAGTGTCTTCAAGCTCCT
GCCCCAGCTGACCTACCTGGATGGCTATGACCGAGAGGATCTGGAAGCCCCCGACTCGGA
TGCCGAGGTGGACGGTGTGGACGAAGAAGAGGAGGACGAAGAGGATGAGGATGGTGAGGA
GGAAGAGTTTGGACATGATGGAGAAGTTGATGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.68
SRP021940_cerebellum 0.85
SRP021940_embryo 2.28
SRP021940_placental_villous 1.21
SRP021940_synovial_membrane 1.9
SRP021940_testis 0.53

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLI-SVSNLPKLPKLKKLELSDNRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLDCLKS
VRELVLDNCKSNDGKIEGLTAEFV..EFLSLINVGLI.SVSNLPKLPKLKKLELSDNRIFGGLD.LAEKLPNLTHLNLSGNKL..I.TLEPLKKLDCLKS
Retrocopy
VRELVLDNCKSNDGKIEGLTAEFVK-EFLSLINVGLI\SVSNLPKLPKLKKLELSDNRIFGGLDVLAEKLPNLTHLNLSGNKLRGIGTLEPLKKLDCLKS


Parental protein
LDLFNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQEAPDSDAEVDGVDEEEEDEEGEDEEDEE-DEDGEEEE
LDLFN.EVTNLNDYRESVFKLLPQLTYLDGYDRED.EAPDSDAEVDGVDEEEEDEE.ED.E.EE...DGE..E
Retrocopy
LDLFNGEVTNLNDYRESVFKLLPQLTYLDGYDREDLEAPDSDAEVDGVDEEEEDEEDEDGEEEEFGHDGEVDE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide