RetrogeneDB ID:
retro_ecab_247
Organism:
Horse ( Equus_caballus )
Location:
11:902588-903020 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.65 %
Coverage:
72.5 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
CRLS1
Parental gene aliases:
No gene alias available
Parental gene description:
cardiolipin synthase 1 [Source:HGNC Symbol;Acc:16148]

Genomic region (view in browser)





>retro_ecab_247
GCCAATCAAAAATCAGCTTTGGGACATGCTCTAACCACTTGTTGATAAAAATACTTATCG
GTATCTTATATGTTCACTTGTCCTATGCAGACCTTACTCCAGTTCCACTGACTGGTATGA
TAATTTCAAGAGATGCAGTGTTGACTGCTGCTGTTTTTTATGTCAGATATCAGACTCTTC
CAACACCACAAACACTTTCTAAGCGTTCCAGTCCTCGCTCTGCCACTGCTAGGTTAAAAC
TAACTTTCATCAGCAAAGGAAATAAAAAGGTCCAGCTATCTTGGTGACAGCTTCTTGGCA
GCTCCAGTTTTCGATTGTGCTGACAGCATCTATCTTCAGATACAGTGGATTTTTATAGTT
TTCACCACAGTTGCATCAGCTTACAGTTATTATCATTATGGTCAGAAAACTGTTCAGGTG
ATAAAAGGCAGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ASQKSALGSAL-DPLADKILISVLYVSLTYADLIPVPLTYMIISRDVMLIAAVFYVRYRTLPTPRTLSKYFNPCYATARLKPTFISKVNTAVQL-ILVAA
A.QKSALG.AL...L..KILI..LYV.L.YADL.PVPLT.MIISRD..L.AAVFYVRY.TLPTP.TLSK...P..ATARLK.TFISK.N..VQL.ILV.A
Retrocopy
ANQKSALGHAL/NHLLIKILIGILYVHLSYADLTPVPLTGMIISRDAVLTAAVFYVRYQTLPTPQTLSKRSSPRSATARLKLTFISKGNKKVQL/ILVTA


Parental protein
S-LAAPVFNYADSIYLQILWCFTAFTTAASAYSYYHYGRKTVQVIKGK
S.LAAPVF..ADSIYLQI.W.F..FTT.ASAYSYYHYG.KTVQVIKG.
Retrocopy
S/LAAPVFDCADSIYLQIQWIFIVFTTVASAYSYYHYGQKTVQVIKGR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide