RetrogeneDB ID:
retro_ecab_25
Organism:
Horse ( Equus_caballus )
Location:
2:60692403-60694575 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.82 %
Coverage:
99.25 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_25
ATGAGGATCACACTCCTGATACACTGGCTTGCAGTGTTTCTGTCCTCCTCTGGACACATG
TGGCCTGAGAACCCCCAGTATCACAGTCCCCCAGAAGTGGTGATTCCCTTGAAGTTACCT
CGTACTGGAAGAGGCATGAAACCTCCAGGCATGCTCTCTTACAGCCTGCATTTTGGAGGC
AAGAGACATGTTGTCCATCTGAGGGTCAAGAAGCATTTGCTGTCTAGACACCTTCCAGTG
TTCACCTACACAGACCAGGGTGCTCTCCTTGAAGAAAAGCCTTTTGTTCAGAATGATTGC
TACTATCATGGTTATGTGGAAGGGGACCTGGAATCCCTGGTTGCCCTCAGTACCTGTTCT
GGTGGATTTCAAGGATTGTTACAGATAAATAGCATTGTTTATGAAATTGAGCCCATGGAT
TTTTCTCCCAAATTTGAACATCTGGTATATAAAATGGATGAGACCCAATTCCCAACCACA
AAATCTGACATTATGCAAGAGGACACTGTACACCAATTGGAGTTTCAAGAGACTGATAAT
TATACTCTGAAGCAAAGTTCTTATGTGGGCTGGTGGGTCCATAAGTTCCTTGTTGAAATG
GCAGTGATTGTGGACCATACTCTCTACCTTCATTATGAAAAGAACGTCTCAAAGTTGCAG
GATGATCTATATGTTATTGTAAATATAGTGGATTCCATTTATGAGGTAATGGGTATTAAG
TTGTTATTACTTGGTATGGAGGTCTGGACTGAAAAAAACTACTTTGAAGTAGGTGATATA
AGCAGATCTCTGAAGCAATTTTGTGAGTGGAAGTCCAAAAATTTTGCTCCCCGCGTGTCA
CATGATACTGCACATCTTTTTACATATAAGACATTAAGAGGATTAACTGGTTTAGGCTTC
GTTGCAGGGCTGTGTAAATCACACAGAAATTGTGCAGTTGTTACTTGTGTTAACAAAACC
TTGTCCATTATTGGAATTGCAATGGCTCATCATCTAGGTCATAATTTGGGGATGTTTCAT
GATGCTGACGAGTGTAAGTGTGCACATCCTACATGTATAATGCGCTATGATAACCCACCA
ATAACTCAATTTAGCAATTGTAGTTATAATTTCTTTTGGGAATATTCTATACGCCAGGCA
AAATGTTTGATGTACACTGTGCATACAAAGGATGTGTTTACAATGAAGCGCTGTGGGAAT
GGCATTGTTGAAGAAGAAGAGGAGTGTGACTGTGGAATTTTAAGGAGTTGTTCAAAAGAT
CCCTGTTGTCTGTCAAACTGCACTCTGAGTTTTGGATCTATTTGTGCTTTTGGGCTTTGT
TGCAAGGACTGCGAGTTTTTACCATCAGGGAGAGTATGTAGAAAGAAAGTCAATGAATGT
GATCTTCCAGAGTGGTGCAATGGAACATCCCATATGTGTCCAGATGATGTATATGTGGAG
GACGGAATTCCTTGTAATAGCAGTGCCTACTGCTATGAAAAAAGCTGTCATAACCGTGAT
GAACAGTGTAGGCAGATCTTTGGCCAAGAGGCAAAGAGTGCAAATAACAGTTGTTACAAA
CGAGTAAACACTAAAGGTGACCGTTTTGGTAACTGTGGTTTCAAAGACTTTTCATATGTA
AAATGTGATAGCTCAGATAGCCTGTGTGGGAGGGTTCAGTGTGAGAATGTGACAAAAATT
CCCCTTTTGAGTGATCATTCTACTGTGCATTGGACTCGCGTCAATGGTGCCATCTGCTGG
GGTATAGACTACCATTTTGGGATGACTACACCTGATATTGGTGATGTGAAAGATGGCACA
GAGTGTGGCCCAGAACACGTCTGCATCCACAGGAAGTGTGTCCATTTATCTCGCTTGGAT
AGTAATTGTTCACCTAAGTTTTGTAACATGAGGGGGATCTGTAACAATAAACATCACTGC
CATTGCAACTATATGTGGGACCCTCCCAATTGCCTAATAAGAGGCAGTGGAGGTAGTATC
GACAGTGGCCCACCCCCTAAGAGAGAGAAGATTAAGAAGATTTACGTGTTAGGATTTGTG
CTTTTTTGGTTGATTGTTTTATTATGTTGTCTTCTTTTGCTTTGTAAGAAGAAAAAATCT
AAGAAAAAAGACCAAAAAGTTCAGGCTGAAGTTAAAAAAGCAGAAAATGTCAAGACACAA
CAACCAAAAGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.0
SRP021940_testis 59.04

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VRLILLLLWLRVFLFLSALSQVGLSSHHGPPEVVIPLRFARSAAGSPVFRWLSYRMNFGGQRHIVHMKVNKHFLYRHLSVFTYTDQGTLLEDQPFVQNDC
.R..LL..WL.VFL..S..........H.PPEVVIPL...R...G......LSY...FGG.RH.VH..V.KH.L.RHL.VFTYTDQG.LLE..PFVQNDC
Retrocopy
MRITLLIHWLAVFLSSSGHMWPENPQYHSPPEVVIPLKLPRTGRGMKPPGMLSYSLHFGGKRHVVHLRVKKHLLSRHLPVFTYTDQGALLEEKPFVQNDC


Parental protein
YYHGYVE-DSESLVSLNTCVGGFQGIIQTMDTIYEITPKRLTI-FEHLVHRIDSEETQSPPMRCGLTDEEIARQLKLQGSDTFTLMRTPYEGWWLHKRYL
YYHGYVE.D.ESLV.L.TC.GGFQG..Q.....YEI.P......FEHLV...D..ETQ.P........E....QL..Q..D..TL....Y.GWW.HK...
Retrocopy
YYHGYVEGDLESLVALSTCSGGFQGLLQINSIVYEIEPMDFSPKFEHLVYKMD--ETQFPTTKSDIMQEDTVHQLEFQETDNYTLKQSSYVGWWVHKFLV


Parental protein
EIAVVVDNNRFIHRDSNVSDVQKEAYEVIHHTNNFFKTVDIEVTLMGIEIWTEGNLILLDDIYRGLRRFCDWKRQGFNDRLPHDAAHIFSGKGFGIVGGL
E.AV.VD.....H...NVS..Q...Y..............I...L.G.E.WTE.N.....DI.R.L..FC.WK...F..R..HD.AH.F..K......GL
Retrocopy
EMAVIVDHTLYLHYEKNVSKLQDDLYVIVNIVDSIYEVMGIKLLLLGMEVWTEKNYFEVGDISRSLKQFCEWKSKNFAPRVSHDTAHLFTYKTLRGLTGL


Parental protein
AYVGTVCNSRHNCGIESFQTEDLVSFANTVTHEVGHTVGMKHDDGTCTCGRSRCIMNAGKGDTHRFSNCSYTWYSELMLR-TKCMYIPPSPERIFTMTRC
..V...C.S..NC.........L........H..GH..GM.HD...C.C....CIM.........FSNCSY....E...R..KC..........FTM.RC
Retrocopy
GFVAGLCKSHRNCAVVTCVNKTLSIIGIAMAHHLGHNLGMFHDADECKCAHPTCIMRYDNPPITQFSNCSYNFFWEYSIRQAKCLMYTVHTKDVFTMKRC


Parental protein
GNSVVEEGEECDCGSL-TCIEDHCCQSNCTLIPEADCAFGLCCQDCKFMPSGTMCRKKENECDLPEWCNGTSHQCPEDVYMQDGFLCKSGDYCYEKRCNN
GN..VEE.EECDCG.L..C..D.CC.SNCTL.....CAFGLCC.DC.F.PSG..CRKK.NECDLPEWCNGTSH.CP.DVY..DG..C.S..YCYEK.C.N
Retrocopy
GNGIVEEEEECDCGILRSCSKDPCCLSNCTLSFGSICAFGLCCKDCEFLPSGRVCRKKVNECDLPEWCNGTSHMCPDDVYVEDGIPCNSSAYCYEKSCHN


Parental protein
RDEQCRKIFGKEAKSANQSCYMRINTRGDRFGHCGLKNTAFVRCNTSDSLCGRVQCENVTKIPFLEEHSTVHWTHFNDVTCWGTDYHYGMTIPDIGEVKD
RDEQCR.IFG.EAKSAN.SCY.R.NT.GDRFG.CG.K....V.C..SDSLCGRVQCENVTKIP.L..HSTVHWT..N...CWG.DYH.GMT.PDIG.VKD
Retrocopy
RDEQCRQIFGQEAKSANNSCYKRVNTKGDRFGNCGFKDFSYVKCDSSDSLCGRVQCENVTKIPLLSDHSTVHWTRVNGAICWGIDYHFGMTTPDIGDVKD


Parental protein
GTECGVDHICIQKKCMPMSHLDRDCSPETCNMKGVCNNRHH-HCNYPWDPPDCLKNGTGGSIDSGPP
GTECG..H.CI..KC...S.LD..CSP..CNM.G.CNN.HH.HCNY.WDPP.CL..G.GGSIDSGPP
Retrocopy
GTECGPEHVCIHRKCVHLSRLDSNCSPKFCNMRGICNNKHHCHCNYMWDPPNCLIRGSGGSIDSGPP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide