RetrogeneDB ID:
retro_ecab_250
Organism:
Horse ( Equus_caballus )
Location:
11:4452120-4452507 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
55.22 %
Coverage:
86.67 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
UBE2V1
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-conjugating enzyme E2 variant 1 [Source:HGNC Symbol;Acc:12494]

Genomic region (view in browser)





>retro_ecab_250
GTAAAATTTACCCCAAATTTTCACTCCCTGGGAGAACTTGAAGAAGGCCAAAGATTAGGT
GATAGTACAGTTAGCTGGAGTCTCTAAGACGATGAAGATATGTTGCTTACAAGGTGGACA
GCCATATAATTGGGCCTCCAAGGACAAATTACAAAAACAAATATATCGCCTCAAAATGGC
AAGTGAATCTAAATACCCAGAAGCTCCCTTATCCTTTAGATTTGTAACAAAAAGTAGTAT
GAATGGAATAAGTAATCCAGTAGAATGGTGGATATACAGAGCATACCATCCAGTGTTAGC
AAAGTAACAAAATACAAAACCAATAAAGTTGCATTTTCAGATCTAAGACATTTAATGATG
TCCAAAGAATATACGAAACTTCTGCAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.1
SRP021940_embryo 0.1
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGM-IIGPPRTIYENR-IYSLKIECGPKYPEAPPFVRFVTKINMNGVNS-SNGVVDPRAI
VK...NF..L.ELEEGQ...GD.TVSW.L.DDEDM.LTRWT...IIGPPRT.Y.N..IY.LK.....KYPEAP...RFVTK..MNG....S...VD...I
Retrocopy
VKFTPNFHSLGELEEGQR-LGDSTVSWSL*DDEDMLLTRWTAI/IIGPPRTNYKNK/IYRLKMASESKYPEAPLSFRFVTKSSMNGISN/SSRMVDIQSI


Parental protein
-SVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQ
.S...K.......KV....LR.LMMSKE..KL.Q
Retrocopy
PSSVSKVTKYKTNKVAFSDLRHLMMSKEYTKLLQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide