RetrogeneDB ID:
retro_ecab_251
Organism:
Horse ( Equus_caballus )
Location:
11:19055387-19055990 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.94 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
JOSD1
Parental gene aliases:
No gene alias available
Parental gene description:
Josephin domain containing 1 [Source:HGNC Symbol;Acc:28953]

Genomic region (view in browser)





>retro_ecab_251
ATGAGTTGCAGGCCATGAAAAGGAGACAAGGCCAAACCTGAACTGTTGGAGCTGCCCCAG
GCAGCCCCCCCAAATCTACCATGAGAAACAGCACAGGGAAACTTTGTGCCCCACGTGCCC
TCAGTAACATCTTCCAGGACAATGCCTTCACCTGGGAAACGCTCCAAGAGATTTGCCAGA
GGTTGTCACCAAACACCGCAGTGAGCCCCCCACAACAAGAGCATGCTGGGAGATGGGAAC
TATGATGTGAACATCATCATGGCAGCACTTCAGACCAAAGGCTATGAAGCTGTGTGGTGG
GACAAACGCAGGGATGTCAGTGCCATTGCTCTGGCTAATGTCGTGGGCTTCGTCATGAAT
CTGCCCTCCAGCCCGTGCTGGGCTCCCCGGAAGTTGCCTCTCCAAAGGCAGCACTGGATC
TGTGCTCAAGAGGTGGGAGGTGCCTACTACAACCTCAACTCCAAACGGAAGGTGCCCAAG
TGGACCGGAGGCGAGAGCGAGCCCAGGAAATTTCTAGAACACCATTTGCAAGGAAAGAAC
TATGAATTGCTGCTGGTGGTAACAGAAGAGGTGGAAGCCCATCAGAGTTGGAGGACTGAT
GTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.1
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.13
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSCVPWKGDKAKSESLELPQAAPPRIYHE-KQRRELCALHALNNVFQDGNAFTRETLQEIFQRLSPNTMVT-PHKKSMLGNGNYDVNVIMAALQTKGYEA
MSC.P.KGDKAK.E.LELPQAAPP....E......LCA..AL.N.FQD.NAFT.ETLQEI.QRLSPNT.V..PH.KSMLG.GNYDVN.IMAALQTKGYEA
Retrocopy
MSCRP*KGDKAKPELLELPQAAPPNLP*E/NSTGKLCAPRALSNIFQD-NAFTWETLQEICQRLSPNTAVS\PHNKSMLGDGNYDVNIIMAALQTKGYEA


Parental protein
VWWDKRRDVSAIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVTEEVEAHQSW
VWWDKRRDVSAIAL.NV.GF.MNLPSS.CW.P.KLPL.RQHWIC..EVGGAYYNL.SK.K.P.W.GGESE.RKFL.HHL.GKN.ELLLVVTEEVEAHQSW
Retrocopy
VWWDKRRDVSAIALANVVGFVMNLPSSPCWAPRKLPLQRQHWICAQEVGGAYYNLNSKRKVPKWTGGESEPRKFLEHHLQGKNYELLLVVTEEVEAHQSW


Parental protein
RTDV
RTDV
Retrocopy
RTDV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide