RetrogeneDB ID:
retro_ecab_257
Organism:
Horse ( Equus_caballus )
Location:
11:46958821-46959163 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.46 %
Coverage:
59.59 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
RHOC
Parental gene aliases:
No gene alias available
Parental gene description:
ras homolog family member C [Source:HGNC Symbol;Acc:669]

Genomic region (view in browser)





>retro_ecab_257
TATTCAAGAACCAACACTCAAGAGAGTTACCAGCCAGGGTGTTTGAGAGCCACCTGGCAG
ACATGGAAGTGGACAGGAAGCAGCTGGAACTGGCTCTGTGGGACATAGCTGGGCAGGAAG
ACTACGACCTCCTGAGGCCTCTCTCCTACCCACACTTCAGCCTTATACCAATCTGCTTCT
CTGTAGTTGCTGTAATAGTTTATAAAACATCGCAGTAAAAGGACCCCTGAGGTCCAACAT
GTCTACACTAATGTGCCCATCATCCTGGTGAACAAGAAGGACCTCCCCTACGATGAATGC
AAAAGACAGTAAAACCTAAAGAAGTCCCCAAAATGGCCTATA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FSKDQFPEVYVP-TVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSI-DSPDSLENIP-EKWTPEVKHFCPNVPIILVGNKKDL
.S.....E.Y.P..VFE...AD.EVD.KQ.ELALWD.AGQEDYD.LRPLSYP....I..CFS......SL.NI...K.TPEV.H...NVPIILV.NKKDL
Retrocopy
YSRTNTQESYQP/RVFESHLADMEVDRKQLELALWDIAGQEDYDLLRPLSYPHFSLIPICFSV/SCCNSL*NIA/SKRTPEVQHVYTNVPIILV-NKKDL


Parental protein
RQDEHTRR-ELAKMKQEPV
..DE..R...L.K....P.
Retrocopy
PYDECKRQ*NLKKSPKWPI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide