RetrogeneDB ID:
retro_ecab_258
Organism:
Horse ( Equus_caballus )
Location:
11:959005-959410 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
54.79 %
Coverage:
69.76 %
Frameshifts:
3
Stop codons:
0


Parental gene:
Parental gene symbol:
LIN28A
Parental gene aliases:
LIN28A, LIN28
Parental gene description:
lin-28 homolog A (C. elegans) [Source:HGNC Symbol;Acc:15986]

Genomic region (view in browser)





>retro_ecab_258
GAGCAGCCACAGCTGCCGTATGGCACTGGCATCCCTAAGTGGGTCTCTGCGCACACAGGG
TTCAGCTCCCTGTCCACGACCACTGCGCCAGGGTCACACTCAACGCCCCAGTGGATGTCT
TTGAGCCCCAGAGAAAGCTGCACACGGAGGGATTCCAGAGCCCCAAGTGGGGCGAGGAAA
CAGAGTTCACCTTTCAGAAGTCCACCAAGGCCTGGAATCTTACCAGCTCTTGGAGGTTTT
CTGTACTGGGAGTGAGAGGCACCAAAGGGGCAGAACACACACAGAAGGAGACGGGCACTC
TAGCTGTGGAGGTCTAGACCAACATGCCAAGGAACCAAGCTGCCATCCCAGCCCAAGAAG
TGCCCCTTTTGCCAGAGCATCAGCCATGTGGCAGCCCCAGCTCCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.17
SRP021940_cerebellum 0.15
SRP021940_embryo 0.77
SRP021940_placental_villous 0.45
SRP021940_synovial_membrane 0.49
SRP021940_testis 2.02

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EEPQLLHGAGICKWFNVRMGFGFLSMTARAG-VALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAK-GLESIRVTGPGGVFCIGSERRPKGKNLQ
E.PQL..G.GI.KW.....GF..LS.T...G.V.L..PVDVF..Q.KLH.EGF.S.K.GE..EFTF.KS.K.GLES........VFC.GSER...G....
Retrocopy
EQPQLPYGTGIPKWVSAHTGFSSLSTTTAPG/VTLNAPVDVFEPQRKLHTEGFQSPKWGEETEFTFQKSTK/GLESYQLLE---VFCTGSERHQRGRT--


Parental protein
KRRSKGDRCYNCGGLDHHAKE-CKLPPQPKKCHFCQSISHMVASCP
.....GD....CGGLD.HAKE..KLP.QPKKC.FCQSISH..A..P
Retrocopy
--HTEGDGHSSCGGLDQHAKE/TKLPSQPKKCPFCQSISHVAAPAP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide