RetrogeneDB ID:
retro_ecab_260
Organism:
Horse ( Equus_caballus )
Location:
11:15098661-15100196 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
81.04 %
Coverage:
90.97 %
Frameshifts:
3
Stop codons:
6


Parental gene:
Parental gene symbol:
USP21
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin specific peptidase 21 [Source:HGNC Symbol;Acc:12620]

Genomic region (view in browser)





>retro_ecab_260
TTACAACCTCTGCCTCCCCTGTCTGGTCCCCCTGAGGAACGGCTCAAGAAACTGGAGCCA
GGACGAGGACCAACCTCAGGCCCTCGTCCCAGAGGCCCTCTTTGGGCATCTCATGGAGTT
CCCCTTCCTGGCTCACTGCCCCCAGCTGTGGCTCTGCCTGTCCCATCCAGGACGAACCTG
GCCCATTCCAGGTCTGTGAGCAGTGGAGACTTGCATCCAATGAGGACTGCCTTGGGAGGG
CACTGTGGCGCTGGAAAGCCAGGGGCTGCGCTGAGCCGCTTGGCACTCTAACCCGAGTCA
CCCACTTTGAGACGTAGCACCTCTCTCCGCCACCTCGGGGCCTTTCCTGGGCCCCCCACC
TTGCTCAGCATATGGACAGAGCCCCCTGCTTCCCATGGCTTCTTCCACGTGATATCTGCC
CGGCCCTCTGAGCCTTTCTACTTTGATGACAAGATGGCTCACCACATGCTGCTTCTGGGC
TTTGGTCACATTGGCCTCCCAAATCTGGGAAATACGTGCTTCCTGAATGCTGTGCTGCAG
TGTTTGAGCAGCACTGGGTCTCTTCGGGACTTCTCTCTGTGAAGGGACCTCCGGCAAGAG
GTGCCTGGAGGGGGCCGAGCCCAAGAGCTCAATGAAGCCTTTGCAGATGTGATTGGTGCT
CCGTGGCACCCTGACTCCTGCGAAGCTGTGAATGGTGCTGGATGACGAGCTGTCTTCTGG
AAACATGTTCCCTCCTTCTCTGGATATAGCCAGCAGGATGCCCACAAGTTCCTGAAGCTC
CTCATGGAGTGGCTGCACCTTGAAATCAACCAATGAGGCCGCCGGGCTCCGTCAGTCTTG
GCCAACAGTCCAGCTCCCTTCTCCACCCCACCAACGGGCTCTGCTAGAAGAATCTGAGTT
AAGTGAAGATGACCGAGCCAACCTAACGTGGAAGTGTTACGTGGAGCAAGAGGACAGCAA
GACTGTGGACCTGTTTGTGGGCCAGTTGAAAAGTTGTCTCTAGTGCCAGGCCTGTGGGTA
TCGTTCCACGACCTTTGAGGTTTTTTGTGACCTGTCCCTGTCCATCCCCAAGAACAGATT
CACTGGGGGCAAGGTGTCTCTGCAGGATGGTTTCAGCCTTTTCACCAAGGAAGAACAGCT
GGAGTTGGAGAATGCCCCAGTGTGTGACCAATGTCGCAGAAAACATGAAGTACCAAAAAG
TTGACAGTACAAAGATGCCCCCGAATCCTTGTGCTCCGTGTTAATCAATTTTATGCCTCC
CGAGGATCCATCAAGAAAAGTTCAATAGGTGTAGACTTCCCACTGCAGCGACTGAGCCTA
GGGGACTTTGCCAGAGATGAAGCCAGAAGCCCCACAGATCAGAGTATGTCCTTTACAACT
ACTCCGGCGGGGTCCACTATGGCCACTACACAGCCCTGTGCCGATACCAGACTGGTTGGC
ATGTCTACAATGACTCTCGTGTCTGCCTTGTTAGTGAAGACCAGGTGGCATCCAGTGAAG
GCTACATGCTGTTCCAGCTGATGCAGGAGCCACCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.36

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LRPLPPRPGPPEERLKKLELGRGRTSGPRPRGPLRADHGVPLPGSPPPTVALPVPSRTNLTRSKSVSSGDLRPMGIALGGHRGAAELGAALSRLALRPEP
L.PLPP..GPPEERLKKLE.GRG.TSGPRPRGPL.A.HGVPLPGS.PP.VALPVPSRTNL..S.SVSSGDL.PM..ALGGH.GA...GAALSRLAL.PE.
Retrocopy
LQPLPPLSGPPEERLKKLEPGRGPTSGPRPRGPLWASHGVPLPGSLPPAVALPVPSRTNLAHSRSVSSGDLHPMRTALGGHCGAGKPGAALSRLAL*PES


Parental protein
PILRRSTSLRRLGGFPGPPTLLSIRTEPPASHGSFHVISGRPSEPFYFDDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFCLRRDFRQE
P.LRRSTSLR.LG.FPGPPTLLSI.TEPPASHG.FHVIS.RPSEPFYFDDKMAHH.LLLG.GH.GL.NLGNTCFLNAVLQCLSST..LRDF.L.RD.RQE
Retrocopy
PTLRRSTSLRHLGAFPGPPTLLSIWTEPPASHGFFHVISARPSEPFYFDDKMAHHMLLLGFGHIGLPNLGNTCFLNAVLQCLSSTGSLRDFSL*RDLRQE


Parental protein
VPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQDAQEFLKLLMERLHLEINRRGRRAPPILANSPA-PSPPRRGGALLEEP
VPGGGRAQEL.EAFADVIGA.WHPDSCEAVN....RAVF.K.VPSFSGYSQQDA..FLKLLME.LHLEIN..GRRAP..LANSPA.PSPP....ALLEE.
Retrocopy
VPGGGRAQELNEAFADVIGAPWHPDSCEAVNGAG*RAVFWKHVPSFSGYSQQDAHKFLKLLMEWLHLEINQ*GRRAPSVLANSPA\PSPPHQ-RALLEES


Parental protein
ELSDDDRANLMWKRYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCFSLFTKEEELESENAPVCDRCR-QKTRS
ELS.DDRANL.WK.Y.E.EDSK.VDLFVGQLKSCL.CQACGYRSTTFEVFCDLSL.IPK..F.GGKVSL.D.FSLFTKEE.LE.ENAPVCD.CR.QKT.S
Retrocopy
ELSEDDRANLTWKCYVEQEDSKTVDLFVGQLKSCL*CQACGYRSTTFEVFCDLSLSIPKNRFTGGKVSLQDGFSLFTKEEQLELENAPVCDQCR/QKT*S


Parental protein
TKKLTVQRFPRILVLHLNRFSASRGSIKKSSIGVDFPLQRLSLGDFASDKAGDPIYQL-YALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQV
TKKLTVQR.PRILVL..N.F.ASRGSIKKSSIGVDFPLQRLSLGDFA.D.A..P..Q..Y.L.N.SG.VHYGHYTALCR.QTGWHVYNDSRV..VSE.QV
Retrocopy
TKKLTVQRCPRILVLRVNQFYASRGSIKKSSIGVDFPLQRLSLGDFARDEARSPTDQS/YVLYNYSGGVHYGHYTALCRYQTGWHVYNDSRVCLVSEDQV


Parental protein
ASSEGYVLFYQLMQEPP
ASSEGY.LF.QLMQEPP
Retrocopy
ASSEGYMLF-QLMQEPP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide