RetrogeneDB ID:
retro_ecab_262
Organism:
Horse ( Equus_caballus )
Location:
11:23309426-23309929 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
69.71 %
Coverage:
100.0 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
TIMM17A
Parental gene aliases:
No gene alias available
Parental gene description:
translocase of inner mitochondrial membrane 17 homolog A (yeast) [Source:HGNC Symbol;Acc:17315]

Genomic region (view in browser)





>retro_ecab_262
GAGGAGTATGAGCTAGAGCCGTGCCCTGGTGAACTATGGAAGACCATGATGGGCCTTTAC
CATGGGAACCATAGGTGGCGGGGTCTTTCAAGCAATTGAAGGTTTTTGTCATTCTCCAGT
AGGAATGAACCAGAGACTACAAGGGAGTTTGACAGCTATTAACACCAGGTCTCCACAGTT
GGGAGGTAGCTTTGCAGTTTGGGGAGGTCTGTGTTCCATGACTGACTGCAGTATGGTTAG
AGAGAACGAAGATCTGTGGAACTCCATCACCAGTCTGCCTCAACAGGAACCACAATGGCA
GCAAGAAATGGACGAGTGGCTATGGTTGTTGGGTCAGCTGTGACGGGTGGCATTCTCCTA
GATTTAACTGGAGGAGCTGGTACCTTGTTGACAAGAATTGCCTTTGCGCACTTTCCCAGT
GGTCCTTAGTTTACTGAGACCCCTCCCGGTTGCCTTCAACCCAGTTACCACCCTCACCTT
TTAGAGACTATGGACAATACCAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.23
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EEYVREPCP-WRIVDDCGG-AFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITS-GAL
EEY..EPCP.W....D..G.AFTMGTIGGG.FQAI.GF..SPVG.N.RL.GSLTAI.TR.PQLGGSFAVWGGL.SM.DCSM..VR..ED.WNSITS..A.
Retrocopy
EEYELEPCP/W*TMEDHDG/AFTMGTIGGGVFQAIEGFCHSPVGMNQRLQGSLTAINTRSPQLGGSFAVWGGLCSMTDCSM--VRENEDLWNSITS/SAS


Parental protein
TGAILAARNGPVAM-VGSAAVGGILLALIEGAGILLTRFASAQFPNGPQFAE-DPSQLPAAQLPSSPFGDYRQYQ
TG...AARNG.VAM.VGSA..GGILL.L..GAG.LLTR.A.A.FP.GP.F.E.DPS.LP..QLP.SPF.DY.QYQ
Retrocopy
TGTTMAARNGRVAMVVGSAVTGGILLDLTGGAGTLLTRIAFAHFPSGP*FTE/DPSRLPSTQLPPSPFRDYGQYQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide