RetrogeneDB ID:
retro_ecab_264
Organism:
Horse ( Equus_caballus )
Location:
11:24920309-24920680 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
92.8 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
HINT1
Parental gene aliases:
No gene alias available
Parental gene description:
histidine triad nucleotide binding protein 1 [Source:HGNC Symbol;Acc:4912]

Genomic region (view in browser)





>retro_ecab_264
ATGAGATCACTGAGGCTCAGGCCGCTTGGCCTGGTGGGGACACGATCTTCCGGAAGATCA
TTCACAAGGAAATCCCAGCCAAAATCATTTTTGAGGATGACCAGTGCCTTGCTTTCCGTG
ACATTTCCCCTCAAGTGCCAACACATTTTCTGGTGATACCCAAAAAACATATATCCCAGA
TTTCTGTAGCAGAAGATGATGATGAAAGTCTTCTTGGACATTTAATGATTGTTGGCAAGA
AATGTGCTGCTGATCTGGGCCTGAAGAACGGTTACCGAATGGTGGTGAATGAAGGTTCAG
ATGGGGGCCAGTCTGTCTATCATGTTCATCTCCATGTGCTTGGAGGTTGGCAGATGAATT
GGCCTCCTGGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.74
SRP021940_cerebellum 3.48
SRP021940_embryo 2.73
SRP021940_placental_villous 3.44
SRP021940_synovial_membrane 1.61
SRP021940_testis 3.14

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MRSPRLRPLGLVGTRSSGRSFAKESQPK-IIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLKKGYRMVVNEG
MRS.RLRPLGLVGTRSSGRSF...SQPK.IIFEDDQCLAF.DISPQ.PTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLK.GYRMVVNEG
Retrocopy
MRSLRLRPLGLVGTRSSGRSFTRKSQPK/IIFEDDQCLAFRDISPQVPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLKNGYRMVVNEG


Parental protein
SDGGQSVYHVHLHVLGGRQMNWPPG
SDGGQSVYHVHLHVLGG.QMNWPPG
Retrocopy
SDGGQSVYHVHLHVLGGWQMNWPPG


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide