RetrogeneDB ID:
retro_ecab_267
Organism:
Horse ( Equus_caballus )
Location:
11:44698131-44698578 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
55.35 %
Coverage:
68.12 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
BAG1
Parental gene aliases:
No gene alias available
Parental gene description:
BCL2-associated athanogene [Source:HGNC Symbol;Acc:937]

Genomic region (view in browser)





>retro_ecab_267
GCCCACAGCAAGGTGATGGGAGGACCAGGCTCAGAGTGAACATCACCCACAGTGAGAAGC
ACGACCTTCACATCACCCCACAGCAGGGCTGCAGTGAACTGATTCACCAAGGCCTGGCCT
GCCTTGCTGAAGAGACAATAGGGGTTCTGTCACCTTTCTAGAAACCAATCGTTAAGGGGA
GATCCTTTAAGGCTATGGAGCAGCCATTGTCAGGACATGGAATGCAGAATGGTGTAACTG
GGACCTAGAATGGTCCAGAGGAAAAGTTTGACTTAAACAAGTTGAACGATTTGGAGAAGT
TTGTGGAGAAGACAGCTGACCAATGGGAGGGGTGAATTAAGAGCTCATGGTTCAGCAGGA
TTTCCTGGCCAAGGATTTGTAGTCCGAAACTCTCTGCAAACTTGATAGGAGAGGAAAGCA
ACAACTGAACAATTGGAGGAGATATTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.12
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ARSEEMAAAG-LSVTVTHSNEKHDLHVTPQEGCSEPIVQDLAQVVEEATGVPLPFQKLIFKGKSLKEMETPLSALGIQNGCRVMLIGKKNSPEEEVELKK
A.S..M...G.L.V..THS.EKHDLH.TPQ.GCSE.I.Q.LA...EE..GV..PF.K.I.KG.S.K.ME.PLS..G.QNG......G..N.PEE...L.K
Retrocopy
AHSKVMGGPG/LRVNITHS-EKHDLHITPQQGCSELIHQGLACLAEETIGVLSPF*KPIVKGRSFKAMEQPLSGHGMQNG----VTGT*NGPEEKFDLNK


Parental protein
LKGLERSVEKIADQLE-ELNKELTGIQQGFLAKDLQAEALCRLDRK-VKATIEQFMKIL
L..LE..VEK.ADQ.E...N.EL...QQ.FLAKDL..E.LC.LDR...KAT.EQ...IL
Retrocopy
LNDLEKFVEKTADQWE/GVN*ELM-VQQDFLAKDL*SETLCKLDRR/RKATTEQLEEIL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide