RetrogeneDB ID:
retro_ecab_269
Organism:
Horse ( Equus_caballus )
Location:
11:49607901-49608075 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
53.33 %
Coverage:
65.93 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
C11orf58
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 11 open reading frame 58 [Source:HGNC Symbol;Acc:16990]

Genomic region (view in browser)





>retro_ecab_269
AAGAAGAAAAAACTTTGGGGACTTACCGGTACGGGAAAGAAAATCCATACCGGTCGTCTT
GTTAAAGGAGACGTCGAATCACCTTCCCACTTCGGAACAGAAGACAAGAAAATGAGTCGA
GAAGGGAAGTCTCAGTATCAGGCAAGAGCGGACAGTACGTTCGCGGGAAGTTTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.25
SRP021940_embryo 0.07
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RKQKFLRLMGAGKKEHTGRLVIGDHKSTSHFRTGEEDKKINEELESQYQQSMDSKLSGRY
.K.K...L.G.GKK.HTGRLV.GD..S.SHF..G.EDKK...E..SQYQ...DS...G..
Retrocopy
KKKKLWGLTGTGKKIHTGRLVKGDVESPSHF--GTEDKKMSREGKSQYQARADSTFAGSF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide