RetrogeneDB ID:
retro_ecab_27
Organism:
Horse ( Equus_caballus )
Location:
Un0007:131391-131979 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.38 %
Coverage:
97.99 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
FAM168B
Parental gene aliases:
No gene alias available
Parental gene description:
family with sequence similarity 168, member B [Source:HGNC Symbol;Acc:27016]

Genomic region (view in browser)





>retro_ecab_27
ATGAATCCTGTTTATAGCCCTGGTTCTTCTGGGGTTCCCTATGCAAATGCCAAAGGAATT
GGTTATCCAGCTGGTTTCCCCATGGGCTACGCAGCAGCGGCTCCCACCTACTCCCCCAAC
ATGTACCCTGGAGCGAACCCCACCTTCCAAACAGGTTACACTCCTGGCACACCTTACAAA
GTGTCCTGTTCCCCCACCAGTGGGGCAGTGCCACCATACTCCTCCTCCCCCAACCCCTAC
CAGACCGCCGTGTACCCCGTGCGAAGTGCCTACCCCCAGCAGAGCCCATACGCACAGCAA
GGCACATACTGCACACAACCCCTGTACGCAGCACCTCCTCACGTCGTCCACCACACCACG
GTGGTGCAACCCAATGGCATGCCGATGACGGTGTACCCTGCACCTATCCCTCCACCTACA
GGCAACGGGGTCACCATGGGCATGGTGGCTGGGACCACTATGGCGATGTCAGCAGGTACC
CTGCTGACTGCCCACTCCCCAACTCCTGTCGCCCCTCACCGAGTCAAGGTGCCCACATAT
CCGGCCCCCGGAACACCCACCTACAGCTACGTGCCCCCTCCGTGGTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.29
SRP021940_cerebellum 1.05
SRP021940_embryo 0.98
SRP021940_placental_villous 0.85
SRP021940_synovial_membrane 1.59
SRP021940_testis 0.59

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSPNPYQTAVYPVRSAYPQQSPYAQQ
MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAP.YSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSPNPYQTAVYPVRSAYPQQSPYAQQ
Retrocopy
MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPTYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSPNPYQTAVYPVRSAYPQQSPYAQQ


Parental protein
GTYYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPIPPPRGNGVTMGMVAGTTMAMSAGTLLTAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW
GTY.TQPLYAAPPHV.HHTTVVQPNGMP.TVYPAPIPPP.GNGVTMGMVAGTTMAMSAGTLLTAHSPTPVAPH.V.VPTY.APGTPTYSYVPP.W
Retrocopy
GTYCTQPLYAAPPHVVHHTTVVQPNGMPMTVYPAPIPPPTGNGVTMGMVAGTTMAMSAGTLLTAHSPTPVAPHRVKVPTYPAPGTPTYSYVPPPW


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide