RetrogeneDB ID:
retro_ecab_271
Organism:
Horse ( Equus_caballus )
Location:
12:6868711-6869763 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.18 %
Coverage:
96.16 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
ACTB
Parental gene aliases:
No gene alias available
Parental gene description:
actin, cytoplasmic 1 [Source:RefSeq peptide;Acc:NP_001075307]

Genomic region (view in browser)





>retro_ecab_271
GACGCCCCCTGCACCGTCTTCCGCTCCATTGTGGGGCACCCCCGGCACCAGGGCGTGATG
GTGGGCATGGGCCAGAAGGACTCGTACGTGGGCGACGAGGCCCAGAGCAAGAGGGGCCTC
CTGACCCCCAAGTACCCCATCGAGCACGGCATCGTCACCAACTGGGACGGCATGGAGAAG
ATCTGGCACCACACCTTCTACAACGAGCTGTGCGTGGCCCCCGAGGAGCACCCCGTGCTG
CTGACTGAGGCCCCCCTGAACCCCAAGGCCAACCGCGAGAAGATGACCCAGATCATGTTC
GAGACCTTCAACACCCTGGCCATGTATGTGGCCATCCAGGCCGTGCTGTCCCTGTACGCC
TCTGGCTGCACCACTGGCATCGTGATGGACTCCGGTGACGGGGTCACCCACACTGTGCCC
ATCTACGAGGGGTACGCCCTCCCCCACACCATCCTGCGTCTGGACCTGGCTGGCCGGGAC
CTGACGGACTACCTCATGAAGATCCTCACGGAGCGTGGCTACAGCTTCACCACCACGGCC
GAGCGGGAAATCGTGCGTGACATTAAGGAGAGGCTCTGCTATGTCGCCCTGGACTTCGAG
CAGGAGATGGCCACCGTGGCCTCCAGCTCTTCCCTGGAGAAGAGCTACGAGCTGCCCCAC
GGCCAGGTCATCACCATCGGCAACAAGCGGTTCCGGGCCCCCGAGGCCCTCTTCCACTCT
CCTTCCTGGGAATGGAATCCAGTGGCATCCACGAAACTGCCTTCAACTCTATCATGAAGT
GTGACGTCGACATCCATAAGGACCTGTATGCCAACACAGTGCTGTCAGGTGGGACCACCC
TGTACCCAGGCATCGCCGACAGGATGCAGAAGGAGATCACAGCCCTGGCTCCCAGCACGA
TGAAGATCAAGATCATCGCGCCCCCCGAGCGCAAGTACTCCGTATGGATTGGCGGCTCCA
TTCTGGCCTCATCGTCCACCTTCCAGCAGATGTGGATCACCAAGCAGGAGTACAACGAGT
CCGGCCCCTCCATAGTCCACCGCAAATGCTTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.7
SRP021940_cerebellum 1.34
SRP021940_embryo 4.91
SRP021940_placental_villous 23.92
SRP021940_synovial_membrane 4.25
SRP021940_testis 2.43

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF
DAP..VF.SIVG.PRHQGVMVGMGQKDSYVGDEAQSKRG.LT.KYPIEHGIVTNWD.MEKIWHHTFYNEL.VAPEEHPVLLTEAPLNPKANREKMTQIMF
Retrocopy
DAPCTVFRSIVGHPRHQGVMVGMGQKDSYVGDEAQSKRGLLTPKYPIEHGIVTNWDGMEKIWHHTFYNELCVAPEEHPVLLTEAPLNPKANREKMTQIMF


Parental protein
ETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFE
ETFNT.AMYVAIQAVLSLYASG.TTGIVMDSGDGVTHTVPIYEGYALPH.ILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKE.LCYVALDFE
Retrocopy
ETFNTLAMYVAIQAVLSLYASGCTTGIVMDSGDGVTHTVPIYEGYALPHTILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKERLCYVALDFE


Parental protein
QEMATAASSSSLEKSYELPDGQVITIGNERFRAPEALFQP-SFLGMESSGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPS
QEMAT.ASSSSLEKSYELP.GQVITIGN.RFRAPEALF...SFLGMESSGIHET.FNSIMKCDVDI.KDLYANTVLSGGTT.YPGIADRMQKEITALAPS
Retrocopy
QEMATVASSSSLEKSYELPHGQVITIGNKRFRAPEALFHS/SFLGMESSGIHETAFNSIMKCDVDIHKDLYANTVLSGGTTLYPGIADRMQKEITALAPS


Parental protein
TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
TMKIKIIAPPERKYSVWIGGSILAS.STFQQMWI.KQEY.ESGPSIVHRKCF
Retrocopy
TMKIKIIAPPERKYSVWIGGSILASSSTFQQMWITKQEYNESGPSIVHRKCF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide