RetrogeneDB ID:
retro_ecab_272
Organism:
Horse ( Equus_caballus )
Location:
12:13514891-13517035 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
90.13 %
Coverage:
88.94 %
Frameshifts:
3
Stop codons:
5


Parental gene:
Parental gene symbol:
TBCK
Parental gene aliases:
No gene alias available
Parental gene description:
TBC1 domain containing kinase [Source:HGNC Symbol;Acc:28261]

Genomic region (view in browser)





>retro_ecab_272
TATTCAAAGGTTTTGTGTATAGCGTTTGAGGTACTTCAGGGCTTGCAGTATATGAACAAA
CATGGTATAGTGCACTGTACACTGTCTCCTCATAATGTCCTTTTGGACCGAAAGGGACAT
GTTAAATTGGCTAAATTTGGACTTTATCACATGACAGCTCATGGTGTCGATGTTGATTTC
CCAATTGGGTATCTGTCCTACTTGGTGCATGAGGTAATTGCACAAGGGATTTCCAAAACG
ACTGATCATGTGCCAAATGGAAAACCATTGCCTTCTGGCCCGAAATCAGATGTATGGTCT
CTTGGAATCATTTTATTTGAGCTTTGCATGGGAAGAAAGTTATTTCAGAGCTTGGAGATT
TCTGAAAGAGTAAATTTTTGCTTACATTGGCCTGTGTGGATGATACTATAATAGTTCTGG
TTGAAGAGCATGGTTGTCTGGACATTGTAAAGGAGCTTTCTCAAAATGTGATGGATCTTT
TGAAGAGGTGCCTCACCTTTCACGCTTCCAACAGGCCAACCCCAGGTGAATTAATGCAGG
ACAAGATATTCAGTGAAATGTCACCTTTATACACCCCCTTTACCAAACCTGCCAGTCTGT
TTCATCTTCTCTGAGATGTGCTTATTTAACTTCACCTGAGGATATCAGTCAGCTGTGTCA
AGACATAAACAGTGATAACCTGGTGGAAAGATCTATTGAAGAAGTGTATTACCTTTAATA
TTTAGCTGGAGGTGACTTGGAGAAAGAGCAGGTCAACAAGGAGATCATTCGGTCCAAGCC
ACCTGTCTGCACACTTCCCAATTTTCTCTTTGAAGATGGTGAAAGCTTTGGACAAGGTCG
AGATAGAAGCTCATTATTAGATGACACCACTGTGACATTGTCATTATGCCAGCTAAGAAA
TAGATTAAAAGATGTTGATGGAGAAGCATTTTACCCGTTACTCGAAGATGACCAGTCTAA
TTTGCCCCATTCAAACAGCAATAACGAGGTGTCTGCAGCTGCCACTCTCCCTTTAATCAT
CCGAGAGAGGGACACAGAGTACTAACTTCACAGAATCGTTCTCTTTCAAAGGCTGCTAAA
GGCGTATCCATATAAAAAAAAATCAGATCTGGAAAGAAGCAAGAGTTGACATTCCTCCTC
TAATGAGAGGTTTAACCTGGGCTGCTCTTCTGGGAGTTGAGGGGGCTATTCATGCAGAGT
ATGATGCAATTGATAAAGATACTTCAGTTCCTACAGATAGACAAATTGAAGTGGATATTC
CTCGTTGTCATCAGTATGATGAACTCTTATAATCACCAGAAGGTCATGCAAAGTTTAGAT
GTGTACTAACAGCCTGGGTGTTGCCCCATCCTGATCTCGTGTATTGGAAAGGTCTTGACT
CAGTTTGTACTCCATAACTATATTTAAATTTCAATAAGGAAGCCCTAGCTTATGCGTGTG
TGTCCGCCTTTATCCCCAAATACCTGTATAATTTCTTGAAAGACAACTCACATGTAATAC
AAGTGTATTTGGCTGTGTTCTCTCAGATGATTGCATTCCATGATCCGGAGCTGAGCAATC
ATCTCAATGAGATGGGGTTTATTCCAGATCTATATGCCATCCCTTGGTTTCTCATCACGT
TTACTCATGTATTTCCACTGCACAAAATTTTCCACCTCTGGGATACCTTACTACTTGGGA
ATTCCTCTTTCCCATTCTGTATTGGAGTAGCAATTCTTCAGCAGCTACGGGACCGGCTTT
TGGCTAATGGCTTTAGTGAGTGCATTCTTCTCTTCTCTGATTTACCAGAAATTGACACTG
AATGCTGTGTATGAGAATCAATCAATCTATTTTGTTGGACTCCTAAAAGTGCTACTAACA
GACAGCATGCTCAGCCTCCAAGGCCGACTTCTGAGGGCAGTGGAGCCAGAAATTCGACTC
CTTATTTCTCCACTGAGTGTGCAGGACCTCCAAAAACAGATCTGTCAAGAGAGTCCATCC
CATTAAATGACCTAAAATCCGAAGTATCCCTGTGGATTTCAGCAGAGGACCTGATTGACT
TGTGCGAGCTCACGGTGACAGGCCACTTCAAAACACCCACCAAGAAAACAAAGTCCAGTA
AACCAAAGTTCCTGGTCGTGGACATTCGGAATACTGAAGAATTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YSKVLCIAFEVLQGLQYMNKHGIVHRALSPHNILLDLKGHVKLAKFGLYHMTAHGDDVDFPIGYPSYLAPEVIAQGISKTTDHVPNGKPLPSGPKSDVWS
YSKVLCIAFEVLQGLQYMNKHGIVH..LSPHN.LLD.KGHVKLAKFGLYHMTAHG.DVDFPIGY.SYL..EVIAQGISKTTDHVPNGKPLPSGPKSDVWS
Retrocopy
YSKVLCIAFEVLQGLQYMNKHGIVHCTLSPHNVLLDRKGHVKLAKFGLYHMTAHGVDVDFPIGYLSYLVHEVIAQGISKTTDHVPNGKPLPSGPKSDVWS


Parental protein
LGIILFELCMGRKLFQSLDISERL-KFLLTLDCVDDTVIVLAEEHGCLDVVKELPENVMGLLKRCLTFHPSNRPTPSELMQDKVFSEVSPSYTPFTKPAS
LGIILFELCMGRKLFQSL.ISER..KFLLTL.CVDDT.IVL.EEHGCLD.VKEL..NVM.LLKRCLTFH.SNRPTP.ELMQDK.FSE.SP.YTPFTKPAS
Retrocopy
LGIILFELCMGRKLFQSLEISERV/KFLLTLACVDDTIIVLVEEHGCLDIVKELSQNVMDLLKRCLTFHASNRPTPGELMQDKIFSEMSPLYTPFTKPAS


Parental protein
LF-SSSLRCADLTLPEDISQLCQDINSDYLAERSIEEVYYLWCLAGGDLEKELVNKEIIRSKPPVCTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQ
LF.SSSLRCA.LT.PEDISQLCQDINSD.L.ERSIEEVYYL..LAGGDLEKE.VNKEIIRSKPPVCTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQ
Retrocopy
LF/SSSLRCAYLTSPEDISQLCQDINSDNLVERSIEEVYYL*YLAGGDLEKEQVNKEIIRSKPPVCTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQ


Parental protein
LRNRLKDVGGEAFYPLLEDDQSNLPHSNSNNELSAAATLPLIIRERDTEYQLHRIVLFDRLLKAYPYKKN-QIWKEARVDIPPLMRGLTWAALLGVEGAI
LRNRLKDV.GEAFYPLLEDDQSNLPHSNSNNE.SAAATLPLIIRERDTEY.LHRIVLF.RLLKAYPY....QIWKEARVDIPPLMRGLTWAALLGVEGAI
Retrocopy
LRNRLKDVDGEAFYPLLEDDQSNLPHSNSNNEVSAAATLPLIIRERDTEY*LHRIVLFQRLLKAYPYXXX\QIWKEARVDIPPLMRGLTWAALLGVEGAI


Parental protein
HAKYDAIDKDTPIPTDRQIEVDIPRCHQYDELLSSPEGHAKFRRVLKAWVVSHPDLVYWQGLDSLCAPFLYLNFNNEALAYACMSAFIPKYLYNFFLKDN
HA.YDAIDKDT..PTDRQIEVDIPRCHQYDELL.SPEGHAKFR.VL.AWV..HPDLVYW.GLDS.C.P.LYLNFN.EALAYAC.SAFIPKYLYNF.LKDN
Retrocopy
HAEYDAIDKDTSVPTDRQIEVDIPRCHQYDELL*SPEGHAKFRCVLTAWVLPHPDLVYWKGLDSVCTP*LYLNFNKEALAYACVSAFIPKYLYNF-LKDN


Parental protein
SHVIQEYLAVFSQMIAFHDPELSNHLNEIGFIPDLYAIPWFLTMFTHVFPLHKIFHLWDTLLLGNSSFPFCIGVAILQQLRDRLLANGFNECILLFSDLP
SHVIQ.YLAVFSQMIAFHDPELSNHLNE.GFIPDLYAIPWFL..FTHVFPLHKIFHLWDTLLLGNSSFPFCIGVAILQQLRDRLLANGF.ECILLFSDLP
Retrocopy
SHVIQVYLAVFSQMIAFHDPELSNHLNEMGFIPDLYAIPWFLITFTHVFPLHKIFHLWDTLLLGNSSFPFCIGVAILQQLRDRLLANGFSECILLFSDLP


Parental protein
EIDIERCVRESINLFCWTPKSATYRQHAQPPRPTSDGSGARSSTPYFSTECADPPKTDLSRESIPLNDLKSEVSPRISAEDLIDLCELTVTGHFKTPTKK
EID.E.CV.ESINLFCWTPKSAT.RQHAQPPRPTS.GSGAR.STPYFSTECA.PPKTDLSRESIPLNDLKSEVS..ISAEDLIDLCELTVTGHFKTPTKK
Retrocopy
EIDTECCV*ESINLFCWTPKSATNRQHAQPPRPTSEGSGARNSTPYFSTECAGPPKTDLSRESIPLNDLKSEVSLWISAEDLIDLCELTVTGHFKTPTKK


Parental protein
TKPSKPKLLVVDIRNTEEY
TK.SKPK.LVVDIRNTEE.
Retrocopy
TKSSKPKFLVVDIRNTEEF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide