RetrogeneDB ID:
retro_ecab_277
Organism:
Horse ( Equus_caballus )
Location:
13:11866988-11867644 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.73 %
Coverage:
88.89 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
RWDD1
Parental gene aliases:
No gene alias available
Parental gene description:
RWD domain containing 1 [Source:HGNC Symbol;Acc:20993]

Genomic region (view in browser)





>retro_ecab_277
TCATTATCTGGAATTACCAGGAAACCCCCCAGCTTCACCATCACTCTGACATCTGAGGCT
GGAGAAAACAGCAAACCTGTCCAGACCACATTCAAGTTCACGTACAGTGAAAAACACCCG
GATGAAGCCCCCTTAATGCAATATTCTCCCAGGAAAATATCTAGAAGACAAGGATGTCTC
CGGCACTTTAAAATTATTAGCACTACAGGCAGAAGAAACCCTTGGCATGGTGATGATTTT
TACTTTAGTGTTGGCTGCACACGAAAAATTATATGAAATAGTAGATCAAATCAAAACCAG
AAGAAAGGCAGGAAGACAAGATACAAAACGGGAAGAAAGTAGGAGCCAAAAAGCAATTAT
TTCATGGTGCTCCTGTTACGATTGAGAATTTCTTAAGTTGCAAGGCCAGGTTTAATGCAA
GACTCTTGGAAATTAAAAAGAAACGTGTGGAAGCAGAACAACAAGCGGGAGAAAGCTGAT
TCGGTGGGAAACAGCGATTCGAATGCTCGTCTCGATTCGTCTTTGACTCTGATGTGTCTG
ACAGCTGGTTGCACGGGTGCTGCCAGCACGTGGAGGTGGACGAGGCTCTGCGCCGGGAAC
CGGCAGACTTGGAGCTGGAGCATGCCCATGGTCCAGGCTGCAATCCTGCTGACCCG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.29
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYE-IFSQENLEDNDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKT
S.......PPSFTIT.TSEAGEN...VQTT.KFTYSEK.PDEAPL...I.....LED.DVS..LKLLALQAEE.LGMVMIFTLV.A..EKL.EIVDQIKT
Retrocopy
SLSGITRKPPSFTITLTSEAGENSKPVQTTFKFTYSEKHPDEAPLMQ\ILPGKYLEDKDVSGTLKLLALQAEETLGMVMIFTLVLAAHEKLYEIVDQIKT


Parental protein
RREEEKKQKEKEAEE-AEKQLFHGTPVTIENFLSWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQLFE-TDHNLDTSDI--QFLEDAGNNVEVDESLFQ
RR.........E....A.KQLFHG.PVTIENFLS.KA.F.A.LLEIKKKR...E.QAG.....GKQ.FE........SD.....L......VEVDE.L..
Retrocopy
RRKAGRQDTKREESR\AKKQLFHGAPVTIENFLSCKARFNARLLEIKKKRVEAEQQAGES*FGGKQRFECSSRFVFDSDVSDSWLHGCCQHVEVDEALRR


Parental protein
EMDDLELEDDEDDPDYNPADP
E..DLELE.....P..NPADP
Retrocopy
EPADLELE-HAHGPGCNPADP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide