RetrogeneDB ID:
retro_ecab_279
Organism:
Horse ( Equus_caballus )
Location:
13:17924339-17924673 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
64.04 %
Coverage:
74.32 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
CALM1
Parental gene aliases:
No gene alias available
Parental gene description:
calmodulin 1 (phosphorylase kinase, delta) [Source:HGNC Symbol;Acc:1442]

Genomic region (view in browser)





>retro_ecab_279
CTTGGGCAAAATGCCATAGAAGCAAATTTTCAGGATAAATTAATGAAGCAAATGATGATG
AAAATACTGCAATTGACTTTCTGGACTTTCTGACAATGATGACAAGAAAAATGAAAGAAA
CAGAGACAAAGAGTAAAGAAGAAATTAGAGAAATATTTCTTGTATTTAATAAGGATAACC
TGGCTATCTTAATGCACCAGAAGTACGTCACACGATAAAACACCTTGGAGAAAATTTAAC
AGATGAAGAGGTTGATGAAATGATCAGAGAAGCAGATATTGACAGTGATAGTCAAGTAAA
CTATGAAGAATTTATGTCAATGATGTCACCAAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.17
SRP021940_cerebellum 0.35
SRP021940_embryo 0.38
SRP021940_placental_villous 0.58
SRP021940_synovial_membrane 0.42
SRP021940_testis 0.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LGQNPTEAELQDM-INEVDADGNGTIDFPEFLTMMARKMKDTD--SEEEIREAFRVFDKDG-NGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDG
LGQN..EA..QD..INE...D.N..IDF..FLTMM.RKMK.T...S.EEIRE.F.VF.KD...GY..A.E.RH....LGE.LTDEEVDEMIREADID.D.
Retrocopy
LGQNAIEANFQDK/INEANDDENTAIDFLDFLTMMTRKMKETETKSKEEIREIFLVFNKDN/PGYLNAPEVRHTIKHLGENLTDEEVDEMIREADIDSDS


Parental protein
QVNYEEFVQMMTAK
QVNYEEF..MM..K
Retrocopy
QVNYEEFMSMMSPK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide