RetrogeneDB ID:
retro_ecab_28
Organism:
Horse ( Equus_caballus )
Location:
11:49074642-49075065 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
96.43 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Profilin [Source:UniProtKB/TrEMBL;Acc:F6UJ33]

Genomic region (view in browser)





>retro_ecab_28
ATGGCCGGGTGGAACGCCTACATCGACAACCTCATGGTGGACGGGACCTGTCAGGACGCG
GCCATCGTGGGCTATAAGGACTCGCCCTCCGTCTGGGCCGCCGTCCCCGGGAAAACCTTC
GTCAACATCACGCCAGCTGAGGTTGGTGTCCTGGTTGGCAAAGGCCGGTCAAGTTTTTTC
GTGAATGGGCTGACACTTGGGGGCCAGAAATGTCCTGTGATCCGGGACTCACTGCTGCAG
GATGGGGAATTTACCATGGATCTTCGCACCAAGAGCACCGGCGGAGCCCCCACCTTCAAC
ATCACTGTCACCATGACTGCCAAGATGCTAGTCCTGCTGATGGGCAAAGAAGGTGTCCAC
GGTGGTATGATCAACAAGAAATGTTATGAAATGGCCTCCCACCTGCGGTGTTCCCAGTAC
TGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.1
SRP021940_embryo 0.41
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.44
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFN
MAGWNAYIDNLM.DGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGK.RSSFFVNGLTLGGQKC.VIRDSLLQDGEFTMDLRTKSTGGAPTFN
Retrocopy
MAGWNAYIDNLMVDGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKGRSSFFVNGLTLGGQKCPVIRDSLLQDGEFTMDLRTKSTGGAPTFN


Parental protein
ITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
ITVTMTAK.LVLLMGKEGVHGGMINKKCYEMASHLR.SQY
Retrocopy
ITVTMTAKMLVLLMGKEGVHGGMINKKCYEMASHLRCSQY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide