RetrogeneDB ID:
retro_ecab_280
Organism:
Horse ( Equus_caballus )
Location:
13:20550217-20550622 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
78.52 %
Coverage:
62.79 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
RAB5B
Parental gene aliases:
No gene alias available
Parental gene description:
RAB5B, member RAS oncogene family [Source:HGNC Symbol;Acc:9784]

Genomic region (view in browser)





>retro_ecab_280
CAGTGGAGAAGTCTAGCTTGGTATTACGATTTGTCAAAAGGCAGTTCCATGAGTACCAAG
AGAGCACCATTGGAGGAAACCTTTGCTCGAGCAAAGACATGGGTAAAGGTACTACAGCGA
CAGGCTAGTCTTAGCATCATTATTGCCCTGGCAGGGAACAAAGCTGACCTGGCCAACAAG
CGCATGGTGGAGTATGAAGAGGCCCAGGTGTATGCAGATGACAACAGCTTATTGTTTATG
GAGACCTCAGCCAAGACAGCTACGAACGTGAATGACCTCTTCCTGGCAATAGGTAAGAAG
TTGCCAAAGAGTGAACCCCAGAATCCAGGGGGTGCAGCAGGCCGAAGCCAGGGTGTGGAT
CTCCATGAGCACTCCCAGCAGAACAAGAGCCAGTGTTGTAGCAAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK
...SLA..Y................ETFARAKTWVK.LQRQAS.SI.IALAGNKADLANKRMVEYEEAQ.YADDNSLLFMETSAKTA.NVNDLFLAI.KK
Retrocopy
QWRSLAWYYDLSKGSSMSTKRAPLEETFARAKTWVKVLQRQASLSIIIALAGNKADLANKRMVEYEEAQVYADDNSLLFMETSAKTATNVNDLFLAIGKK


Parental protein
LPKSEPQNPGGAAGRSRGVDLHEQSQQNKSQCCSN
LPKSEPQNPGGAAGRS.GVDLHE.SQQNKSQCCSN
Retrocopy
LPKSEPQNPGGAAGRSQGVDLHEHSQQNKSQCCSN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide