RetrogeneDB ID:
retro_ecab_283
Organism:
Horse ( Equus_caballus )
Location:
13:40083976-40084644 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
92.41 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
TWSG1
Parental gene aliases:
No gene alias available
Parental gene description:
twisted gastrulation homolog 1 (Drosophila) [Source:HGNC Symbol;Acc:12429]

Genomic region (view in browser)





>retro_ecab_283
GTGAAGTCACACCGTGTTGTTATGCTTACTCTAGCTGTCCTGGGGTTGCTGACATGGGTC
CCCGTGTCACTGAGTTGCAATAAAGCTCTCTGTGCTGGTGATGTGAGCAAATGCCTAATT
CAGGAGCTTTGCCAGTGCCGACCCGGAGAAGGGAATTGTTCCTGCTGTAAGGAGTGCATG
CTGTGTCTTGGAACCCTTTGGGATGAGTGCTGTGATTGCGTTGGTACGTGTAATCCTCGA
AATTATAGTGACATACCTCCAACTTCAAAGAGCACGGTGGAAGAGCTTCATGAGCCCATC
CCTTCTCTCTCCCGGGCTCTCACAGAAGGAGATACTCAGTTGAACTGGAACATCGTTTCC
TTCCCTGTTGCAGAAGAACTTTCACATCATGAGAATCTGGTTTCATTTTTAGAAACAGTG
AACCAGCCACACCACCAAACTGTGTCTGTTCCCAGCAATATGTTCACGCACCTTATTCCA
GTGACAAAGAACACATGTGTATTGTGGTTTACTTTGATGACTGCGTGTCCATACATCGGT
GTAAAATATTCTGTGAGTCCATGGGGGCAGCCAAATACCGCTGGTTCCATAACGCCTGCT
GCGAGCGCATTGGTCCAGAGTGTATCGACTATGGTAGTAAGACTGTCAAATGTATGAACT
GCACGTTC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKSHCVVMLTLAVLVLLTWVPVSLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGTLWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPI
.KSH.VVMLTLAVL.LLTWVPVSLSCNKALCA.DVSKCLIQELCQCRPGEGNCSCCKECMLCLGTLWDECCDCVG.CNPRNYSD.PPTSKSTVEELHEPI
Retrocopy
VKSHRVVMLTLAVLGLLTWVPVSLSCNKALCAGDVSKCLIQELCQCRPGEGNCSCCKECMLCLGTLWDECCDCVGTCNPRNYSDIPPTSKSTVEELHEPI


Parental protein
PSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSN-NVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNA
PSL.RALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQ.VSVPSN..VHAPYSSDKEHMC.VVYFDDC.SIH.CKI.CESMGA.KYRWFHNA
Retrocopy
PSLSRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQTVSVPSN/YVHAPYSSDKEHMCIVVYFDDCVSIHRCKIFCESMGAAKYRWFHNA


Parental protein
CCECIGPECIDYGSKTVKCMNCMF
CCE.IGPECIDYGSKTVKCMNC.F
Retrocopy
CCERIGPECIDYGSKTVKCMNCTF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide