RetrogeneDB ID:
retro_ecab_286
Organism:
Horse ( Equus_caballus )
Location:
13:17703868-17704363 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
68.82 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
DAZAP2
Parental gene aliases:
No gene alias available
Parental gene description:
DAZ associated protein 2 [Source:HGNC Symbol;Acc:2684]

Genomic region (view in browser)





>retro_ecab_286
ATGAACAGCAAAGGTCAATGTCTAACACAGCCAGCCTACCCTGTGCAGCCTCCTGGGAAT
CCACTGTACCCTTAACCTTGCATCTTTCTCAGGTTCCACCCCATACTGATGCTCCATCTG
CCTACTCAGAGCTCTGTCATCTGAGCTCTGCGTGCACCCGGGGGCTGCCACAGTCCCCAC
CATGTCAGCCGCTTTTCTTTGCCCTCACTGTATCTTCCCATGGCCCAGTAAGTGGCTATT
GGTCCTTTAGGTTCCACAATCCCCATGGCTTATTATCTCATCTATCCATCTGGTTCTATT
GTGCTGGTAGAAGGAGGGTATGATATAGGTGCTAGATTTGGAGCTGGGGCTACTGCTGGC
AGTGTTCCTCCTCTACTCCCAGGATGCCCTCCCAAAGCTGCTCAGCTTGCAGTCATGCAA
GGAACCAGTGTCGTTGTAACTCAGTCAAAGGGAAACTTCTTCATGGGTGGCTCAGGAGGT
GACCACACCATCTGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.15
SRP021940_embryo 0.34
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.36

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MNSKGQYPTQPTYPVQPPGNPVY-PQALHLPQAPPYTDAPPAYSELYRPSFV-HPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIY
MNSKGQ..TQP.YPVQPPGNP.Y.P..LHL.Q.PP.TDAP.AYSEL...S....PG....P.....F...SLYLPMAQ.VA.GPLGSTIPMAYY....IY
Retrocopy
MNSKGQCLTQPAYPVQPPGNPLY/PLTLHLSQVPPHTDAPSAYSELCHLSSA\APGGCHSPHHVSRFSLPSLYLPMAQ*VAIGPLGSTIPMAYY---LIY


Parental protein
PPGSTVLVDGGYDAGARFGAGAAAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
P.GS.VLV.GGYD.GARFGAGA.AG..PP..PGCPP.AAQLAVMQG..V.VTQ.KGNFFMGGS.G..TIW
Retrocopy
PSGSIVLVEGGYDIGARFGAGATAGSVPPLLPGCPPKAAQLAVMQGTSVVVTQSKGNFFMGGSGGDHTIW


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide