RetrogeneDB ID:
retro_ecab_287
Organism:
Horse ( Equus_caballus )
Location:
13:19396971-19397518 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
82.16 %
Coverage:
82.81 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
FAM60A
Parental gene aliases:
No gene alias available
Parental gene description:
family with sequence similarity 60, member A [Source:HGNC Symbol;Acc:30702]

Genomic region (view in browser)





>retro_ecab_287
CAGAGTTGGTTTGGGTTGCATGAGACTCGTTCAGTAGACATCTGTAATGCCTGTGGCCTG
CTTGTGAAAAGATGGAAGGAATTGCCAGAGGATCAAAAAAACCCTGGAATCAAGTGGTAG
ATACAAGAACAGGACCCAATCTAAAGATTACATTGAAACCAAAGAAAGTGAACACTCTAT
CTGGAAACAGGATAAAAAGCAACCATGTCAGTAAACTGCAGAAGGAATTCAAACGTCACA
ATTCTCATGCTCATGGTAACACCTCAAGTTCCTCCCCAGCTCACTCTCCTTGTTATAGTA
ACCAATTGGATGATGGCTCGGATACAGCGATGGCTTCTGGCTTTAGCAGAACACCAGTTT
TTCCTTTTTAGATCTCACATACTGGAAAAGACAGAAAATATGTTGTGGGATTATCTATAA
AGGCCGTTTTGGGGAAGTCCTCATCAACACACATCTATTCAAGCCTTGCTGCAGCAATAA
GGAAGCAGCTGCTGAGAAGCAGGAGGAGCAGGGGCCCGAGCCTCTGAACATCTCCACTCA
GGAGTGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.1
SRP021940_embryo 0.1
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.12

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QSCFGLHETRSGDICNACVLLVKRWKKLPA-GSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCY
QS.FGLHETRS.DICNAC.LLVKRWK.LP..GSKK.WN.VVD.R.GP.LK.TLKPKKV.TLSGNRIKSN..SKLQKEFKRHNS.AH..TSS.SPA.SPCY
Retrocopy
QSWFGLHETRSVDICNACGLLVKRWKELPE/GSKKPWNQVVDTRTGPNLKITLKPKKVNTLSGNRIKSNHVSKLQKEFKRHNSHAHGNTSSSSPAHSPCY


Parental protein
SNQSDDGSDTEMASGSNRTPV-FSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQRPEPLPLPPQEW
SNQ.DDGSDT.MASG..RTPV.FSFLDLTYWKRQKICCGIIYKGRFGEVLI.THLFKPCCSNK.AAAEK.EEQ.PEPL....QEW
Retrocopy
SNQLDDGSDTAMASGFSRTPV/FSFLDLTYWKRQKICCGIIYKGRFGEVLINTHLFKPCCSNKEAAAEKQEEQGPEPLNISTQEW


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide