RetrogeneDB ID:
retro_ecab_290
Organism:
Horse ( Equus_caballus )
Location:
13:42390704-42391237 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
82.68 %
Coverage:
76.52 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
ACER3
Parental gene aliases:
No gene alias available
Parental gene description:
alkaline ceramidase 3 [Source:HGNC Symbol;Acc:16066]

Genomic region (view in browser)





>retro_ecab_290
CTACTGGATGAACTCCCAATGATGTACAGCTGTTGTGTATTTGTGTACTGCATGTTTGAA
CGTTTCAAGATGAAGAACTCAGTAAACTATCATCTGCGTTTTACCTTAATTCTCTTCAGT
TTAAAGTCACCACAGTTTGCCTTAAGGTAAAGGAGCCTGTATTTCAGCAGGTCATGCATG
GAATGTTGGTCTTCACATTAGCACTTCCATCTGTTTATATTGTTACATAGGTTTATCCAT
GGCTAAGAGGACTCGGTTTTACATCCTTGGGTCTATTTTTATTGGGATCTTTATTATAGA
ACACAGATAACATCTTTTGCGAATCACTAAGGAACTTTCGAAAGAAGGTGCCACCTATCA
TAGGTGTTACCACACAATTTCAGGCATGGTGGCATATTTTAACTGGCCTTGGTTCTTATC
TTCACATCCTTTTCAATTTATATACAAGAACACTTTACCTGAGATACAGGCCAAAAGTGA
AGTTTCTCTTGGGAATCTGGCCAGTGATCCTGTTTGAGCCTCTCAGGAAGCAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.41
SRP021940_cerebellum 0.4
SRP021940_embryo 0.74
SRP021940_placental_villous 0.89
SRP021940_synovial_membrane 0.57
SRP021940_testis 1.48

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LLDELPMIYSCCIFVYCMFECFKMKNSVNYHLLFTLVLFSLI-VTTVYLKVKEPIFQQVMYGMLVFTLVLRSVYIVTWVYPWLRGLGYTSLGLFLLGFLL
LLDELPM.YSCC.FVYCMFE.FKMKNSVNYHL.FTL.LFSL..VTTV.LKVKEP.FQQVM.GMLVFTL.L.SVYIVT.VYPWLRGLG.TSLGLFLLG.LL
Retrocopy
LLDELPMMYSCCVFVYCMFERFKMKNSVNYHLRFTLILFSLK/VTTVCLKVKEPVFQQVMHGMLVFTLALPSVYIVT*VYPWLRGLGFTSLGLFLLGSLL


Parental protein
WNIDNIFCESLRNFRKKVPPIIGVTTQFHAWWHILTGLGSYLHILFR-EIETFSLNLFPK-QFLFGIWPVILFEPLRKH
.N.DNIFCESLRNFRKKVPPIIGVTTQF.AWWHILTGLGSYLHILF.....T..L...PK..FL.GIWPVILFEPLRKH
Retrocopy
*NTDNIFCESLRNFRKKVPPIIGVTTQFQAWWHILTGLGSYLHILFNLYTRTLYLRYRPKVKFLLGIWPVILFEPLRKH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide