RetrogeneDB ID:
retro_ecab_292
Organism:
Horse ( Equus_caballus )
Location:
14:8758221-8758640 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.99 %
Coverage:
59.47 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
NUDT21
Parental gene aliases:
No gene alias available
Parental gene description:
nudix (nucleoside diphosphate linked moiety X)-type motif 21 [Source:HGNC Symbol;Acc:13870]

Genomic region (view in browser)





>retro_ecab_292
GTACCCCATGTGTTCCTGCTGCAGCTGGGGACAACTTTCTTCAAAGCGTTGGGTGGTGAA
CTTAACCCAGGAGAAGACGAAGAGGAAGAAGGTGAATTTGAAGGACCAAAACTCCTACTG
ACAGACATACTGGGTGGTTGAAGTGGAGTCCCGCCAGACTGGGTCATGATGCCTGCACGG
GTAACCAGTAGGGACCAAATTTGGAGCCTCCTCAGTATGCATATATTCCTGCACATATTA
CAAAGCCTCCAGAACAGAAGAAGTTGTTTTTCATTCAACTTCAAGAGAAAGCCTTGTCTG
AGGCCCCTAAAAATTACAAGTCGACAGCTGCACCACTGTTTGAACTGAGTGCCCAGGCAC
CAGGCTGTGGACCCGTCAGTTTTCATCTCCCTTGGCTTCTGAGCAGGTTCAGTTTTCTA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.2
SRP021940_embryo 0.43
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.36
SRP021940_testis 1.31

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LPHVLLLQLG-TTFFKLPG----GELNPGEDEVEGLKRLMTEILGRQDGVLQDWVI-DDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKAL
.PHV.LLQLG.T.F..L.G....GE....E.E.EG.K.L.T.ILG...GV..DWV..D.C.GN...PN.EPPQY.YIPAHITKP.E.KKLF..QLQEKAL
Retrocopy
VPHVFLLQLGTTFFKALGGELNPGEDEEEEGEFEGPKLLLTDILGG*SGVPPDWVM/DACTGNQ*GPNLEPPQYAYIPAHITKPPEQKKLFFIQLQEKAL


Parental protein
FAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFI
...PKNYK..AAPLFEL...APG.GP....LP.LLSRF.F.
Retrocopy
SEAPKNYKSTAAPLFELSAQAPGCGPVSFHLPWLLSRFSFL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide