RetrogeneDB ID:
retro_ecab_297
Organism:
Horse ( Equus_caballus )
Location:
14:58379397-58379701 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.86 %
Coverage:
57.54 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
UBE2C
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-conjugating enzyme E2C [Source:HGNC Symbol;Acc:15937]

Genomic region (view in browser)





>retro_ecab_297
AGTCAGACAACATTCAAATGAGTGAGGCCCATCCATGGAGCAGCCAGAACAGTCTGTGAA
GACCTGAGGTACCTCTCCCTGAGTTCTCCAGTGGCTTCCAGCACAGCATACTCATGGTAA
AGCTCTTTGTGCCTGGCTACCACCCCCATATGGACACCAGGGTCACGTCTACCTGGACAT
CCTGGAGGAGAAGTGGTCAGCCCTGTGTGACATCAGGACCATCCTGCTGTCCATGCAGAG
TCCACTAGGAGAACCCAACATCCACAGCCCTTTAAAAACACATGCTGCTAAGTTCTGGAA
ACAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SDNLFKWVGTIHGAAGTVYEDLRYKLSL-EFPSGYPYNAPTVKFLTPCYHPNVDT-QGNICLDILKDKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAA
S...FK.V..IHGAA.TV.EDLRY.LSL.EF.SG.......VK...P.YHP..DT.QG...LDIL..KWSAL.D.RTILLS.QS.LGEPNI.SPL.THAA
Retrocopy
SQTTFK*VRPIHGAARTVCEDLRY-LSL/EFSSGFQHSILMVKLFVPGYHPHMDT/QGHVYLDILEEKWSALCDIRTILLSMQSPLGEPNIHSPLKTHAA


Parental protein
ELWKN
..WK.
Retrocopy
KFWKH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide