RetrogeneDB ID:
retro_ecab_299
Organism:
Horse ( Equus_caballus )
Location:
14:65274505-65275163 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.86 %
Coverage:
82.53 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
BTG4
Parental gene aliases:
No gene alias available
Parental gene description:
B-cell translocation gene 4 [Source:HGNC Symbol;Acc:13862]

Genomic region (view in browser)





>retro_ecab_299
GATGAAATTGCAACAACAGTTTTCTTTGTTACGAGATTAGTGAAAAAACATAAGTTGAGT
AAACAGCAAATAGAAGACTTTGTAAAACAGTTGATGACAAACTTGTTTGAAACATACAGA
AGTCACTGGTACTCTGGTTACCTTTCTAATGGGCAAGGCTTCAGGTATATCGGGATAAAC
CATTAGAATAAAGATCACATCCTAGAAAGGGCTCATGCTGAAAGTGAAGTGGATTTTTCT
CACCCTAGACTTCCGAAGGAGAGGAGCATTTAGGTAGATCACTTTGAAGTTTGCTATAGG
TATGGTGAGAAAAATCATCTATTTACAGTTCTTCTTTTAAAGGCAGATGGGAGGAATGAG
GACTCTCCCAGCAAATCAGTTATGTTCTTGGTAGAGCCAGATTAGACTGCTCCTCTGCCA
CTTCCTTCAGTGAAGAAAGTTGTAACAAAGAACCTCAGATAATTCCTGAAGTCAGCAATC
CAAAGAGTATTTGTCAGATTGAAAACTTGAAACGACTCTTTTAATATTGGTTCCAAATCA
CCCACAAAAAGAATATGGTGATGGCCATATGGGCATCCTAGGGAATGTTTATCAAGTGTT
GTATAAGAACCCTGAGGGTCATAGGCCTGTTGCTATACACAGGGTGGGCAGGTACCAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DEIATTVFFVTRLVRKHDRLSKQQIEDFAEKLITILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERACAESNVDFSHLGLPKEMTIWVDPFEVC
DEIATTVFFVTRLV.KH..LSKQQIEDF...L.T.LFETYRSHW.S...S.GQ.FR.I.IN...NKD.ILERA.AES.VDFSH..LPKE..I.VD.FEVC
Retrocopy
DEIATTVFFVTRLVKKH-KLSKQQIEDFVKQLMTNLFETYRSHWYSGYLSNGQGFRYIGINH*-NKDHILERAHAESEVDFSHPRLPKERSI*VDHFEVC


Parental protein
CRYGEKNHPFTI-ASFKGRWEERELSQQISYAVSRATLDSSPGSSSDEEGCNQEPQIIPKVNNPKSIYQVENLKRPFQSWFQIPRKNNMV-DGRMGLLEN
.RYGEKNH.FT...SFKGRWEE..LSQQISY...RA.LD.S...S..EE.CN.EPQIIP.V.NPKSI.Q.ENLKR.F..WFQI..K.NMV.DG.MG.L.N
Retrocopy
YRYGEKNHLFTV/SSFKGRWEE*GLSQQISYVLGRARLDCSSATSFSEESCNKEPQIIPEVSNPKSICQIENLKRLF*YWFQITHKKNMV/DGHMGILGN


Parental protein
AYHVLHKNPKGHRAAAIHTLEFYN
.Y.VL.KNP.GHR..AIH....Y.
Retrocopy
VYQVLYKNPEGHRPVAIHRVGRYH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide