RetrogeneDB ID:
retro_ecab_303
Organism:
Horse ( Equus_caballus )
Location:
14:92709751-92710492 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
81.38 %
Coverage:
94.51 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TAF9B
Parental gene aliases:
No gene alias available
Parental gene description:
TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa [Source:HGNC Symbol;Acc:17306]

Genomic region (view in browser)





>retro_ecab_303
ATGGAGTCTGGCAAGATGGCTTCTCCCAAGAGCATGCCGAAAGATGCACAGATGATGGCA
CAGATCCTGAAGGATATGGGCATTACAGAGTACGAGCCAAGAGTTATAAATCAGATGTTG
GAGTTTGCCTTCCGATATGTGACCACAATTCTAGATGATGCAAAAATTTATTCAAGCCAT
GCTAAGAAAGCTACTGTTGATGCCGATGATGTGCGATTGGCAATCCAGTGTCGTGCTGAC
CAGTCTTTTACCTCTCCTCCCCCAAGAGATTTTTTATTGGATATTGCACGGCAAAGAAAT
CAAACCCCTTTGCCATTGATCAAGCCCTATTCGGGCCCTAGGTTGCCACCTGATAGATAT
TGTTTGACTGCTCCAAATTATAGACTTAAGTCTTTACAGAAAAAGGCATCTACTTCTGCG
GGAAGAATAACAGTTCCGCGGTTAAGTGTTGGTTCAGTTACTAGCAGACCAAGTACTCCC
ACTCTTGGCACACCAACCCCACAGACCGTGTCTGTTTCAACCAAGGTAGGGACTCCAGTA
TCCCTCACAGGGCAGAGGTTTACGGTGCAGATGCCCACCTCGCAGTCCCCAGCTGTAAAA
GCGTCCATTCCTGCAACATCAGCAGTTCAGAATGTTCTGATTAATCCGTCATTAATCGGG
TCCAAAAACATTCTTATTACCACTAACATGGTGTCATCACAGAATACTGCCAGTGAATCA
TCAAATACATCGAAAAGAAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 9.23
SRP021940_cerebellum 24.74
SRP021940_embryo 29.99
SRP021940_placental_villous 18.29
SRP021940_synovial_membrane 12.87
SRP021940_testis 181.03

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKN
MESGKMA.PK..P.DA..MAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKK..VDADDVRLAIQCRADQSFTSPPPRDFLLDIARQ.N
Retrocopy
MESGKMASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRN


Parental protein
QTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLVKKGA-NQGRL-VPRLSVGAVSSRPTTPTVA--TPQTVSVPNKVAPPASVTSQRFTVQIPPSQSTPVK
QTPLPLIKPY.GPRLPPDRYCLTAPNYRLKSL.KK.....GR..VPRLSVG.V.SRP.TPT....TPQTVSV..KV..P.S.T.QRFTVQ.P.SQS..VK
Retrocopy
QTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTVSVSTKVGTPVSLTGQRFTVQMPTSQSPAVK


Parental protein
-PVPATTAVQNVLINPSMIGSKNILITTNMVSSQNMANE-SNPLKRK
...PAT.AVQNVLINPS.IGSKNILITTNMVSSQN.A.E.SN..KRK
Retrocopy
ASIPATSAVQNVLINPSLIGSKNILITTNMVSSQNTASESSNTSKRK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide