RetrogeneDB ID:
retro_ecab_308
Organism:
Horse ( Equus_caballus )
Location:
14:12391870-12392564 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.5 %
Coverage:
73.8 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
FBL
Parental gene aliases:
No gene alias available
Parental gene description:
fibrillarin [Source:HGNC Symbol;Acc:3599]

Genomic region (view in browser)





>retro_ecab_308
GTGGAGCCGCACCGGCACGAGGGCGTCTTCATCTACCGCGGGGCGGAAGGACGCTCTGGT
CACGCTGAACATGGTGCCCGGCCACTCGGTGTACGGCGAGCGGCGGGTCACGGTGACCGA
GGGCGGCGTCAAGCAGGAGTACCGCACGTGGAACCCCTTCCGCTCCAAGCTGGCTGCGGC
CATCCTGGGCGGAGTCGACCAGATCCACATCAAGCCCAAGTCCAAAGTGCTGTATCTGGG
CGCCGCCTCGGGGACCACTGTCTCCCACGTCTCTGACATCATCGGCCCCGACGGGCTGGT
CTACGCGGTCGAGTTCTCCCACCGCGCTGGCCGCGATCTGGTCAACGTGGCCAAGAAGCG
AACCAACATCATCCCAGTCCTCGAAGATGCCCGGCACCCGCTCAAGTACCGCATGCTCAT
TGGGATGGTGGACGTGATCTTCGCCGACGTCGCCCAGCCGGACCAGTCCCGCATCGTGGC
TCTGAACGCCCACACCTTCCTGCGCAACGGGGGCCACTTCCTCATTTCCATCAAGGCCAA
CTGCATCGACTCGACTGCGTCTGCCGAGGCGGTGTTTGCTTCTGAGGTGAGGAAGTTGCA
GCAGGAGAACTTAAAGCCCCAGGAGCAGCTGACACTGGAGCCCTATGAGCGGGACCACGC
GGTGGTCGTCGGGGTCTACCGGCCGCTTCCCAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 17.62
SRP021940_embryo 3.79
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 3.44

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VEPHRHEGVFICRGKE-DALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGL
VEPHRHEGVFI.RG.E.DALVT.N.VPG.SVYGE.RV...EG..K.EYR.WNPFRSKLAAAILGGVDQIHIKP..KVLYLGAASGTTVSHVSDI.GPDGL
Retrocopy
VEPHRHEGVFIYRGAE\DALVTLNMVPGHSVYGERRVTVTEGGVKQEYRTWNPFRSKLAAAILGGVDQIHIKPKSKVLYLGAASGTTVSHVSDIIGPDGL


Parental protein
VYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKM
VYAVEFSHR.GRDL.N.AKKRTNIIPV.EDARHP.KYRMLI.MVDVIFADVAQPDQ.RIVALNAHTFLRNGGHF.ISIKANCIDSTASAEAVFASEV.K.
Retrocopy
VYAVEFSHRAGRDLVNVAKKRTNIIPVLEDARHPLKYRMLIGMVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANCIDSTASAEAVFASEVRKL


Parental protein
QQENMKPQEQLTLEPYERDHAVVVGVYRPPPK
QQEN.KPQEQLTLEPYERDHAVVVGVYRP.PK
Retrocopy
QQENLKPQEQLTLEPYERDHAVVVGVYRPLPK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide