RetrogeneDB ID:
retro_ecab_31
Organism:
Horse ( Equus_caballus )
Location:
2:28779756-28780503 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.27 %
Coverage:
96.33 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
YWHAZ
Parental gene aliases:
No gene alias available
Parental gene description:
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:HGNC Symbol;Acc:12855]

Genomic region (view in browser)





>retro_ecab_31
ATGGAGAGAGCCAGTCTGATCCAGAAGGCCAAGTTGGCAGAGCAGGCCGAACGCTATGAG
GACATGGCAGCCTTCATGAAGAGCGCCGTGGAAAAGGGTGAGGAGCTATCCTGCGAAGAG
CGAAACCTCCTCTCAGTGGCCTACAAGAATGTGGTGGGTGGCCAGAGGGCTGCCTGGAGA
GTCCTGTCCAGTATCGAGCAGAAAGGCAATGAGGAAGGCTCGGAAGAGAAGGGCCCTGAG
GTGCAAGAATACCGGGAGAAGGTGGAGACCGAGCTCCGGGGTGTGTGTGACACTGTGCTG
GGCCTGCTGGACACCCACCTCATCAAGGAGGCCGGTGATGCCGAAAGCCGGGTTTTCTAC
CTGAAAATGAAGGGCGACTACTACCGCTACCTAGCCGAGGTGGCCACTGGTGACAACAAG
AAGCGCATCATCGACTCAGCCCGGTCGGCCTACCAGGAGGCCATGGACATCAGCAAGAAG
GAGATGCCGCCCACCAACCCCATCCGTCTGGGCTTGGCCCTGAACTTTTCCGTCTTCCAC
TACGAGATCGCCAACAGCCCTGAGGAGGCCATCTCGCTGGCCAAGACCACCTTCGATGAG
GCCATGGCTGACCTGCACACCCTCAGCGAGGACTCCTACAAAGACAGCACCCTCATCATG
CAGCTGCTGCGAGACAACCTGACGCTGTGGACGGCAGACAACGCCGGGGAAGAGGGCGGC
GAGGCTCCCGAGGAGCCCCAGAGCTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.28
SRP021940_cerebellum 0.5
SRP021940_embryo 4.5
SRP021940_placental_villous 141.52
SRP021940_synovial_membrane 2.42
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQK--TEGAEKKQQMAREYREKIETELRDICNDVL
M....L.QKAKLAEQAERY.DMAA.MKS..E.G.ELS.EERNLLSVAYKNVVG..R..WRV.SSIEQK...EG.E.K.....EYREK.ETELR..C..VL
Retrocopy
MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKGNEEGSEEKGPEVQEYREKVETELRGVCDTVL


Parental protein
SLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDE
.LL...LI..A..AES.VFYLKMKGDYYRYLAEVA.GD.KK.I.D....AYQEA..ISKKEM.PT.PIRLGLALNFSVF.YEI.NSPE.A.SLAKT.FDE
Retrocopy
GLLDTHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDNKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDE


Parental protein
AIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDE
A.A.L.TLSE.SYKDSTLIMQLLRDNLTLWT.D..G.E
Retrocopy
AMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide