RetrogeneDB ID:
retro_ecab_317
Organism:
Horse ( Equus_caballus )
Location:
14:57207766-57208120 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.19 %
Coverage:
65.56 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
AK3
Parental gene aliases:
No gene alias available
Parental gene description:
adenylate kinase 3 [Source:HGNC Symbol;Acc:17376]

Genomic region (view in browser)





>retro_ecab_317
GAAATTGGTGTGCTGGCCACAATTTTCATGGATCAGGAGAAGCTCATCCCCGACAACATT
CTGACTCGGCTGACCTTTCACGAGCTAAAAAAGCTCTCCCAGTTTAGCTGGCTGTTGTGT
GGTTTCCCCAGGATGCTTCCACAAGCTGAAGCCCTGGATAGAGTTTATCAGATACTCCTG
GCCAGGAACCTAAATGTGCCCTTTGAGGTCATCAAGCAGCGCCTAACTGCTCGCTGGGTT
CATCCAGCCGGTGGCGGCATCTACAACCTCGAATTTAACCCTCCCAAAGGGGTTGACATG
GACGATCTGACTGGAGAGCCTCTCGTTCAGCTTGAGGATGATGGACCAGAGACT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
EIGVLAKTFIDQGKLIPDDVMTRLALHELKNLTQHSWLLDGFPRTLPQAEALDKAYQIDTVINLNVPFEVIQHRLTARWIHPASGRVYNMEFNPPKTLGV
EIGVLA..F.DQ.KLIPD...TRL..HELK.L.Q.SWLL.GFPR.LPQAEALD..YQI....NLNVPFEVI..RLTARW.HPA.G..YN.EFNPPK....
Retrocopy
EIGVLATIFMDQEKLIPDNILTRLTFHELKKLSQFSWLLCGFPRMLPQAEALDRVYQILLARNLNVPFEVIKQRLTARWVHPAGGGIYNLEFNPPKGVDM


Parental protein
DDVTGEPLVQREDDKPET
DD.TGEPLVQ.EDD.PET
Retrocopy
DDLTGEPLVQLEDDGPET


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide