RetrogeneDB ID:
retro_ecab_318
Organism:
Horse ( Equus_caballus )
Location:
14:67188428-67189767 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.41 %
Coverage:
98.9 %
Frameshifts:
9
Stop codons:
9


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_318
CGCCAGTGCAAGTTTGTCCACGTGTGGTAGGTAGAAGTCCAGATTGGTAATGCCTCCTGG
GAATTGTACTGCCTTGAACTTGGAATTTAGCCCAATGGTCAAATGCCGAGTGACAAAACC
ACTGCTGGTGGGGATGACTCCTTCAAGACATTCTTCGGGGAGATTGGGGCTAGCCAGCAC
ATGCCCAAAGCAGGGTCTGTGGACCTGGAGCCACCGCAGTCAATAGAGTGCACACGGGAC
ATATAGGCAGCTCTTCTACTCAGAGTAGATGGTCACCGGGAAGAAATATACAGCCAATAA
TTAGGCCAAAGGCCATTACATCATCGGCAAGGAGATCATTGACCTAGTCCTGGACCGGAT
CCAAAAACTGGCAGATTTCTGCATGGGGCTGTGAGGCTTCCTCATCTTCCACAGCTTCAG
TGCAGCACCAGCTCTGGGTTTGTGTCTCTGCTCATGAAGCAGCACTTGGTAGAATGTGGC
ACAAAGTCTAAGCTCAAATTTGCCATTTACCCAGTCTCCCATGTTTCTAAAGCCATAGTG
GACCCCCTACAACTCCATCCTGACCACTCACACAATACATAAAATTATGACTGTGCCTTC
ATGGTAGATAAGGAAGCCAGCTACGACATATGTGGGCACAACCTGGTTGTCCAATGGCCC
ATGTACACTGACCTCAGTTGTGGGATTGGGCAGATCATGTCCACCATCAACACCTCCCAT
CGATTTGATGGGGCCCTGAAAGTGGACTTGATGGAATTCCCAACCAACCTGGTCCCTACC
CCCACATCTACTTCCCCCTGGCTACCTATGCCTGGTCATCTCAACCAAGACTGTCTACTA
CAAGCAGCTGTCAGCGGCCAAGACCACCAATGCCTACTTCTAGCTAGCAAACCAGATGGT
CAAGTATGACCCTTGCCATGGGAAGTACATGCCTGCTGCATGTTGTATGGGGGGACCCGT
CCTGAAGATGTCAACGCGGCTGTCCCCACCATCGAGACCAAGCACACCATCCAGTTTGTG
AATTGGAGCTCAAGTGGATTTAAGGTGGGCATCAACTACCAGCCCCCCAGCTGTCATCCC
TGGGGGAAACATGAGCAATATTCAGTGGGCCATGTGTATGCTGGGCAACAGCACTGCCCT
CACCAAGGCCTGGGCACGCCTGGACCATAAGTTCAATCTCACCTATGCAAGGTGAACATT
CGTGCCCTGATACATGGGGGAAGTCATGGAGGAAGCAGACTTCTCTGAGGTCCTGGGGGA
CCTGGCAGCCCTGGAGAAAGATTACAAAGAGGTGGGCACAGATCCCATGGAAGCAGAGGC
CAGATGATGGGCAGAATAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.17
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEP-TVVDEVRTG-TYRQLFHPEQLITGKEDA
R.C...HV....VQIGNA.WELYCLE.GI.P.GQMPSDKT..GGDDSF.TFF.E.GA..H.P.A..VDLEP.T.V..V.TG.TYRQLF..E...TGK...
Retrocopy
RQCKFVHVW*VEVQIGNASWELYCLELGI*PNGQMPSDKTTAGGDDSFKTFFGEIGASQHMPKAGSVDLEP/TAVNRVHTG/TYRQLFYSE*MVTGKKYT


Parental protein
ANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGG-TGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEP-YNSILTTHTTLE-
ANN.A.GHY.IGKEI.DLVLDRI.KLAD.C.GL.GFLIFHSF....T.SGF.SLLM....V..G.KSKL.FAIYP...VS.A.V.P.YNSILTTHT....
Retrocopy
ANN*AKGHYIIGKEIIDLVLDRIQKLADFCMGL*GFLIFHSFSAA/TSSGFVSLLMKQHLVECGTKSKLKFAIYPVSHVSKAIVDP\YNSILTTHTIHK/


Parental protein
HSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVP-YPRIHFPLATYA-PVISAEKAYHEQLSVAEITNA
..DCAFMVD.EA.YDIC..NL....P.YT.L...IGQI.S.I..S.RFDGAL.VDL.EF.TNLVP.YP.I.FPLATYA..VIS....Y..QLS.A..TNA
Retrocopy
NYDCAFMVDKEASYDICGHNLVVQWPMYTDLSCGIGQIMSTINTSHRFDGALKVDLMEFPTNLVP/YPHIYFPLATYA/LVISTKTVYYKQLSAAKTTNA


Parental protein
CFEPANQMVKCDPRHGKYM-ACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPT-VVPGGDLAKVQRAVCMLSNTTAIAEAWARLD
.F..ANQMVK.DP.HGKYM.ACCMLY.G...P.DVNAA..TI.TK.TIQFV.W...GFKVGINYQPP..V.PGG.....Q.A.CML.N.TA...AWARLD
Retrocopy
YF*LANQMVKYDPCHGKYM/ACCMLY-GGTRPEDVNAAVPTIETKHTIQFVNWSSSGFKVGINYQPPS\VIPGGNMSNIQWAMCMLGNSTALTKAWARLD


Parental protein
HKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSVEAEAEEGEEY
HKF.L.YA...FV..Y.GE.MEE..FSE...DLAALEKDY.EVG.D..EAEA....EY
Retrocopy
HKFNLTYAR*TFVP*YMGEVMEEADFSEVLGDLAALEKDYKEVGTDPMEAEAR*WAEY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide