RetrogeneDB ID:
retro_ecab_32
Organism:
Horse ( Equus_caballus )
Location:
11:28877674-28879693 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.44 %
Coverage:
59.35 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
KIF2A
Parental gene aliases:
No gene alias available
Parental gene description:
kinesin heavy chain member 2A [Source:HGNC Symbol;Acc:6318]

Genomic region (view in browser)





>retro_ecab_32
ATGGCCAGCCAGTTATGCTTCCCTGTCGCTCCCCACCTCTCGTCCTCAAAACCCTTGAAG
CCACACTTCGGAGTTCAACTGGGCCTCTGTGTGGCGATCCAGCGCAGCGACGGACGGATC
CACCACGCTGTGGTGACCGAGATCAAAAGAGAAAATGCTTGGGTCGCCGTAGAGTGGGTT
GAAAAAGGAGTCAAAAAAGGCAAGAAGGTTGATCTAGAGACCATATTCCTACTGAATCCA
GCTCTGGTTTCTGTTGAACAGCCCCCACCGTCCAGGTCATTGCCCTCCTTGTCTCTAGGG
CCCTCTTCGGCCATCGGGGACCAGCGCAAAGCCACGCGGTGGATTGCAACAATCCCCCAG
AAAAACGAAACGCCCTCAGGGGACAGCCTGACTGTGAGAGTCCCCAGCAATCCTTGCCTG
ATGAAGCAGAAAAAGTCTCCCTGCCTTCGGGAAGTTGAGAAACTGCAAAAGCAGCGGGAG
AAGCGCAGGCAGCTGCAGATGGAGATCAGAGCCCAACGTGCCCTCAGAGTCAACACGGGA
AACCCCAACTACGAGATGTTGCGCATGATCGAAGAGTACCGCAGGCACCTGGACCTCAGC
AAGGTGTCCCTCCTGGAACCGCGGGAAGACCATCGCATCTGCGTCTGCGTGAGAAAGCGG
CCTCTCAGCCAGCAAGAGACCACCATGAAGGACCTGGATATCATCACCATCCCCTCCAAC
AACGTGGTCATGGTACACGAGTCCAAGCAAAAGGTGGACCTCACTCGCTACCTGGAGAAC
CAGATCTTTTGCTTCGATCATGCCTTCGATGACACCGCCTCCAACGAGTTAGTGTACCAG
TTCACTGCCCAGCCACTGGTGGAGTCCATCTTCCGTAAGGGCATGGCCACCTGCTTTGCC
TATGGGCAGACGGGCAGTGGGAAAACGCATACGATGGGCGGAACTTTTTCTGGAAGGGAC
CAAGATTGTTCTAAAGGCATTTATGCCCTGGTGGCGCAGGATGTCTTCTTCCTACTCAAA
ACCTTGACTTATGAGAAGCTAGACCTCAAAGTCTATGGGAGCTTTTTTGAGATTTACGGG
GGCAAGGTGTATGATTTGTTGAACTGGAAGAAGAAGTTGCAAGTCCTTGAGGATGGCAAT
CAGCAAATCCAGGTGGTCGGGCTACAGGAACAGGAGGTATGTTGTGTGGAGGACGTGCTG
CACCTCGTGGAACTAGGGAACAGCTGCCGGACTTCAGGACAGACCTCTGTCAACGCCCAC
TCTTCCAGGAGCCACGCCATCTTCCAGATCATTCTAAAGTCGCGAGGGAAACTGCACGGC
AAGTTTTCCCTCGTTGACTTAGCTGGGAACGAAAGGGGAGCAGACACTGCCAAGGCCAAC
CGGAAAAGGCAGCTGGAAGGGGCGGAGATCAATAAGAGTCTCCTGGCTCTCAAAGAATGC
ATTCGGGCTTTGGGTCAGCACAAGTCCCATACCCCATTCAGAGCCAGCAAACTCACACAG
GTGCTCCGGGACTCCTTCATAGGCCAGAACTCCTCCACTTGCATGATTGCTACTATTTCT
CCAGGGATGACCTCTTGCGAAAACACCCTCAACACTTTAAGATATGCAAATAGAGTAAAA
GAATTAACTCTTGATTTAAGGCCCCACCATCGTTGTCTCTATCCAGTTGGACAGGAGGTG
CCTAAGATGTTGGAAAAACACATTAGAAATTCAGAAATGTCCTTTCAGAGGGATAAATTT
ATTGAAAGACCTTGTATACAGACTGAGGAGGAGGAAGAGACTAAAGAAATGAAACCAGTA
GCCACTCCATTAATGGAGGATACAACGAGTTCTGGGAGGAAATCAAGCCAATGGCCAGGG
ACCAACATCCAGGACACAGCCGATGCGGTAAACTATGATGTTGATCTTTGCATTGCCCAG
TTATTGTCCATTTTGGAGCAGAAAGTAGATATTCTGGCTGAGATTCAAAAGAAACTGAAA
TTATTACGAGCTGACTTCCAAAAGAAGAGCAAGTCTAGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.22
SRP021940_synovial_membrane 0.0
SRP021940_testis 318.16

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RRKSNCVKEVEKLQEKREKRRLQQQELREKRAQDVDATNPNYEIMCMIRDFRGSLDYRPLTTADPIDEHRICVCVRKRPLNKKETQMKDLDVITIPSKDV
..KS.C..EVEKLQ..REKRR..Q.E.R..RA..V...NPNYE...MI...R..LD........P...HRICVCVRKRPL...ET.MKDLD.ITIPS..V
Retrocopy
QKKSPCLREVEKLQKQREKRRQLQMEIRAQRALRVNTGNPNYEMLRMIEEYRRHLDLSKVSLLEPREDHRICVCVRKRPLSQQETTMKDLDIITIPSNNV


Parental protein
VMVHEPKQKVDLTRYLENQTFRFDYAFDDSAPNEMVYRFTARPLVETIFERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFLMLKKP
VMVHE.KQKVDLTRYLENQ.F.FD.AFDD.A.NE.VY.FTA.PLVE.IF..GMATCFAYGQTGSGKTHTMGG.FSG..QDCSKGIYAL.A.DVF..LK..
Retrocopy
VMVHESKQKVDLTRYLENQIFCFDHAFDDTASNELVYQFTAQPLVESIFRKGMATCFAYGQTGSGKTHTMGGTFSGRDQDCSKGIYALVAQDVFFLLKTL


Parental protein
NYKKLELQVYATFFEIYSGKVFDLLNRKTKLRVLEDGKQQVQVVGLQEREVKCVEDVLKLIDIGNSCRTSGQTSANAHSSRSHAVFQIILRRKGKLHGKF
.Y.KL.L.VY..FFEIY.GKV.DLLN.K.KL.VLEDG.QQ.QVVGLQE.EV.CVEDVL.L...GNSCRTSGQTS.NAHSSRSHA.FQIIL...GKLHGKF
Retrocopy
TYEKLDLKVYGSFFEIYGGKVYDLLNWKKKLQVLEDGNQQIQVVGLQEQEVCCVEDVLHLVELGNSCRTSGQTSVNAHSSRSHAIFQIILKSRGKLHGKF


Parental protein
SLIDLAGNERGADTSSADRQTRLEGAEINKSLLALKECIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCMIATISPGMASCENTLNTLRYANRVKEL
SL.DLAGNERGADT..A.R...LEGAEINKSLLALKECIRALG..K.HTPFRASKLTQVLRDSFIG.NS.TCMIATISPGM.SCENTLNTLRYANRVKEL
Retrocopy
SLVDLAGNERGADTAKANRKRQLEGAEINKSLLALKECIRALGQHKSHTPFRASKLTQVLRDSFIGQNSSTCMIATISPGMTSCENTLNTLRYANRVKEL


Parental protein
TVD
T.D
Retrocopy
TLD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide