RetrogeneDB ID:
retro_ecab_323
Organism:
Horse ( Equus_caballus )
Location:
15:10330901-10331217 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
72.64 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL37
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L37 [Source:HGNC Symbol;Acc:10347]

Genomic region (view in browser)





>retro_ecab_323
CTTTGGTCTTGGCTGCAGAAACAAGATGATGAAGGAAATGTTATCATTTGGAAAGCATCA
CAATAAGACCCACATGTTGTACCGCTGTTGTGGCTCTAAGGCCTGCCACCTTCAGAAGTC
GACCTGTGGCAAATGTGGCTACCCTGCCAAGTAGAAGAGAAAGTATAACTGGAATGCCAA
GGCTAAAAGATGAAATACCACTGGGACTGGTCCAATGAGGCAGCGAAAAATTGTATACCA
CAGATTCAGGCATGGATTCTGTGAAGGAACAACACCTAAACCCAAGATGGCAGCTGTTGC
AGCGTTCAATTCATCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LWSRPQKR-DDEGNVIVRKA-NKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAV
LWS..QK..D.....I.....NKTH.L.R.CGSKA.HLQKSTCGKCGYPAK.KRKYNW.AKAKR.NTTGTG.MR..KIVY.RFRHGF.EGTTPKPK.AAV
Retrocopy
LWSWLQKQDDEGNVIIWKAS\NKTHMLYRCCGSKACHLQKSTCGKCGYPAK*KRKYNWNAKAKR*NTTGTGPMRQRKIVYHRFRHGFCEGTTPKPKMAAV


Parental protein
AASSSS
AA..SS
Retrocopy
AAFNSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide