RetrogeneDB ID:
retro_ecab_324
Organism:
Horse ( Equus_caballus )
Location:
15:15501899-15502705 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
98.52 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_ecab_324
GCAACAAAGGTTTTGGGAACAGTAAAATGGCTCAATGTAAGAAACGGATATGGTTTCATC
AACAGGAATGACACCAAGGAAGATGTATTTGTACACCAGACTGCCATAAAGAAGAATAAC
CCCAGGAAGTACCTTCGCAGTGTAGGAGATGGAGAGACTGTGGAGTTTGATGTTGTTGAA
GGAGAAAAGGGTGCGGAGGCAGCAAATGTTACAGGTCCTGGTGGAGTTCCAGTGCAAGGA
GTAAATATGCAGCAGACCGTAACCATTATAGACGCTATCCACGTCGCAGGGGTCCTCCAC
GCAGTTACCAGCAGAATTACCAGAATAGTGAGAGTGGGGGAAAGAATGAGGGATCGGAGA
GCGCTCCCGAAGGCCAGGCCCAACAGCGCCGGCCCTACCGCAGGCGACGGTTCCCACCTT
ACTACATGCGGAGACCCTATGGGCGTCGACCACAGTATTCCAACCCTCCTGTGCAAGGAG
AAGTGATGGAGGGTGCTGACAACCAGGGTGCAGGAGAACAAGGTAGACCAGTGAGGCAGA
ATATGTATCGGGGTTATAGACCACGATTCCGCAGGGGCCCTCCTCGCCAAAGACAGCCTA
GAGAGGATGGCAATGAAGAAGATAAGGAAAATCAAGGAGATGAGACCCAAGGTCAGCAGC
CACCTCAACGTCGGTACCGCCGCAACTTCAATTACCGACGCAGACGCCCAGAAAACCCTA
AACCACAAGATGGCAAAGAGACAAAAGCAGCCGATCCACCAGCTGAGAATTCGTCCGCTC
CCGAGGCTGAGCAGGGCGGGGCTGAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.15
SRP021940_embryo 1.39
SRP021940_placental_villous 0.54
SRP021940_synovial_membrane 0.89
SRP021940_testis 3.44

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQG-SKYAADRNHYRRYPRRRGP
ATKVLGTVKW.NVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQG.SKYAADRNHYRRYPRRRGP
Retrocopy
ATKVLGTVKWLNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQG/SKYAADRNHYRRYPRRRGP


Parental protein
PRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQ
PR.YQQNYQNSESG.KNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQ
Retrocopy
PRSYQQNYQNSESGGKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQ


Parental protein
PREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
PREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
Retrocopy
PREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide