RetrogeneDB ID:
retro_ecab_328
Organism:
Horse ( Equus_caballus )
Location:
15:39329475-39329823 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
67.23 %
Coverage:
98.32 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
RPS20
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S20 [Source:HGNC Symbol;Acc:10405]

Genomic region (view in browser)





>retro_ecab_328
GCTTTGAAAGATATCAGAAAGACACCTACGGAACCAGAGGTGGCGATTCATCAAATGAGA
ATCACCCTAACTAGTGACAGTGTAAGACCTCTGGAGAAGGTGTGTGCTGACTTGATCCGA
GGCACAAAAGAAAATCTCAAAGTGAAAGGACCAGGTGGGAGGCCTATCGAGACTCTGGGA
ATCACTAAAAGAAAAACTCTTTGTGCTGTAAGGTTCTTAGACTTGGGATTTTTTCAGATC
AGTATCTACGAGTGACTCACTACCTTGGACAGTCCTTCTGAGATTGTTAAGCAGATTACT
TCCATCAGTATTTAGCCAGGAGAAGAGGCTCAAGTCACCAGTGCAGAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.4
SRP021940_embryo 0.24
SRP021940_placental_villous 0.13
SRP021940_synovial_membrane 0.08
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AFKDTGKTPVEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGE-GSKTWDRF-QMRIHKRLIDLHSPSEIVK
A.KD..KTP.EPEVAIH..RITLTS..V..LEKVCADLIRG.KE.NLKVKGP...P..TL.IT.RKT.C...GS.TWD.F.Q..I...L..L.SPSEIVK
Retrocopy
ALKDIRKTPTEPEVAIHQMRITLTSDSVRPLEKVCADLIRGTKE-NLKVKGPGGRPIETLGITKRKTLCAV\GS*TWDFF/QISIYE*LTTLDSPSEIVK


Parental protein
QITSISIEPGVEVEVTIAD
QITSISI.PG.E..VT.AD
Retrocopy
QITSISI*PGEEAQVTSAD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide