RetrogeneDB ID:
retro_ecab_330
Organism:
Horse ( Equus_caballus )
Location:
15:48805092-48806178 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.56 %
Coverage:
65.59 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
PTBP1
Parental gene aliases:
No gene alias available
Parental gene description:
polypyrimidine tract binding protein 1 [Source:HGNC Symbol;Acc:9583]

Genomic region (view in browser)





>retro_ecab_330
TTCTACCCGGTGACCCTGGACGTGCTCCACCAGATCTTCTCCAAGTTCGGCACGGTGCTG
AAGATCATCACCTTCACCAGGAACAACCAGTTCCAGGCGCTGCTGCAGTACGCGGAGGCT
GTGAGCGCGCAGCACGCCAAGCTGTCGCTGGACGGCCAGAACGTCTACAACGCCTGCTCC
ACGCTGCGCATCGACTTCTCCAAGCTCACCAGCCTCAACGTCAAGCACAAGAGCGGCGAC
TACGCGCGCCCCGACCTGCCCTCGGGCGACAGCCAGCCTTCGCTGAACCAGACCATGGCC
GAGCCTTTCGTTGCGCTTGGTATAATGTCAGCCTCTCCATATGCAGGAGCTGGTTTCTCT
CCCACCTTTGCCAGTCCTCAAGCCGCAGGCCTCTCTGTTTCCCAACGTGCACGGGGCATT
GGCCCCCCGGCCATTCCCGTCCGCGGCGCAGCGGCAGCAGCGGGCAGGATCGCCTCTCCC
GGACCTGGCTGGGCCGGGAACTCCGTGCTGCTGGTCAGCAACCTGAACCCCGAGAGAGTC
ACACCCCAAAGCCTCTTTATTCTTTTCAGCGTGTACGGTGACATGCAGCGGGTGAAGATC
CTCTTCAACAAGAAGGAGAACGCGCTGGTGCAGATGGCCGACGGCAGCCAGGCCCAGCTG
GCCATGAGCCACCTCAACGGGCACAAGCTGCACGGGAAGCCGGTGCGCATCACGGCGTCC
AAGCACCAGAACGTGCAGCTGCCCCGCGAGGGCCAGGAGGACCAGGGCCTCACCAAGGAC
TACGGTAGCTCGCCGCTGCACCGCTTCAAGAAACTGGGCTCCAAGAACTTCCAGAACATC
TTCCCGCCCTCCGCCATCCTGCACCTCTCCAACATCCCGCCATCCAAATCCGAGGACGAC
CTCAAGATCCTCTTCTCCAGCAACGGCGGGATTGTCAAGGGGTTCAAGTTCTTCCAGAAG
GACCAGAAGATGGCGTTGATCCAGATGGGCTCGGTGGAGGACGCGATCCTGGCGCTCATC
AACCTGTACAACCACGACCTGGGCGAGAACCACCACCTGCGGGTCTCCTTCTCCAAGTCC
ACCATC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 2.67
SRP021940_cerebellum 1.0
SRP021940_embryo 8.03
SRP021940_placental_villous 2.28
SRP021940_synovial_membrane 4.22
SRP021940_testis 2.91

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYAEPVSAQHAKLLLDAQNIYNARCTLRIDFSK-TSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQ
FYPVTLDVLHQIFSKFGTVLKIITFT.NNQFQALLQYAE.VSAQHAKL.LD.QN.YNA..TLRIDFSK.TSLNVK....KS.DY.RPDLPSGDSQPSL.Q
Retrocopy
FYPVTLDVLHQIFSKFGTVLKIITFTRNNQFQALLQYAEAVSAQHAKLSLDGQNVYNACSTLRIDFSKLTSLNVKH---KSGDYARPDLPSGDSQPSLNQ


Parental protein
TMAAAFGAPGIMSASPYAGAGFPPTFAIPQAAGLSV-PNVHGALAPLAIPSAA-AAAAAGRIALPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGDV
TMA..F.A.GIMSASPYAGAGF.PTFA.PQAAGLSV.PNVHGALAP...PSAA.AAAAAGRIA.PG...AGNSVLLVSNLNPERVTPQSLFILF.VYGD.
Retrocopy
TMAEPFVALGIMSASPYAGAGFSPTFASPQAAGLSV\PNVHGALAPRPFPSAA/AAAAAGRIASPGPGWAGNSVLLVSNLNPERVTPQSLFILFSVYGDM


Parental protein
QRVKILFNKKENALVQMADGSQAQLAMSHLNGHKLHGKPVRITLSKHQNVQLPREGQEDQGLTKDYGSSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPS
QRVKILFNKKENALVQMADGSQAQLAMSHLNGHKLHGKPVRIT.SKHQNVQLPREGQEDQGLTKDYGSSPLHRFKK.GSKNFQNIFPPSA.LHLSNIPPS
Retrocopy
QRVKILFNKKENALVQMADGSQAQLAMSHLNGHKLHGKPVRITASKHQNVQLPREGQEDQGLTKDYGSSPLHRFKKLGSKNFQNIFPPSAILHLSNIPPS


Parental protein
ISEDDLKILFSSNGGIVMGFKFFQKDRKMALIQMGSVEEAIQALIDLHNHDLGENHHLRVSFSKSTI
.SEDDLKILFSSNGGIV.GFKFFQKD.KMALIQMGSVE.AI.ALI.L.NHDLGENHHLRVSFSKSTI
Retrocopy
KSEDDLKILFSSNGGIVKGFKFFQKDQKMALIQMGSVEDAILALINLYNHDLGENHHLRVSFSKSTI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide