RetrogeneDB ID:
retro_ecab_331
Organism:
Horse ( Equus_caballus )
Location:
15:55384343-55384689 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.56 %
Coverage:
62.7 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
RPL17
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L17 [Source:HGNC Symbol;Acc:10307]

Genomic region (view in browser)





>retro_ecab_331
GTTCCCTATTCAGTTGACCCAGAAGACCCCACAAAGTCATTCAAATCAAGAGGTCCAAAT
CTTCGTGTTCTCTTTAAGAACACCCGTGAAACGACCCTGGTCACCAAGGACATGCATACC
CGAAAGCCTCCGGGTATCTGAAGGGTGTCACTTTACAGAGGCAGCATGTGCTGTCCCGTT
GCTACAACGGCAGAGTTGGTAGGGCTGCCCCGGGCAAACTGTGCGGCTGGACATGGGGTC
AGGGTCCCGAAGGAGTGCTGAATGTTTGCTGCACGGGATTGAAAACGAAGAGGGCAAAGC
AGAACTTAGCGGTTCAGATGTCGATTCTCTCGTCATTGAGCACATA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIR-KATKYLKDVTLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWP-KKSAEFLLHMLKNAE
V.YS.DPE.PTKS.KSRG.NLRV.FKNTRET....K.MH.R.KA..YLK.VTL..Q.V..R.YNG.VGR.A..K..GWT.G..P...SAE.LLH...N.E
Retrocopy
VPYSVDPEDPTKSFKSRGPNLRVLFKNTRETTLVTKDMHTR/KASGYLKGVTLQRQHVLSRCYNGRVGRAAPGKLCGWTWGQGP/RRSAECLLHGIENEE


Parental protein
SNAELKGLDVDSLVIEHI
..AEL.G.DVDSLVIEHI
Retrocopy
GKAELSGSDVDSLVIEHI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide