RetrogeneDB ID:
retro_ecab_333
Organism:
Horse ( Equus_caballus )
Location:
15:69070247-69070859 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.24 %
Coverage:
61.26 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
G3PDH
Parental gene aliases:
GAPDH, G3PDH
Parental gene description:
glyceraldehyde-3-phosphate dehydrogenase [Source:RefSeq peptide;Acc:NP_001157328]

Genomic region (view in browser)





>retro_ecab_333
TCTGGCAAAGTGGATATTGTTGGCATCAATGACCCCTTCACTGACCTCAACTACATGCCC
TCCATGTTCCAGTATGAGTCCACCCATGGCAAGTTCAATAGCACAGTCAAGGCTGAGAGC
GGGAAGCTTGTCATCAATGGAAAGCCCATCTCCATTTTCTCGGAGCAAGATCCCACCAAC
ATCAAATGGGATGCTACTGGTGTTGAATGTGTTGTGCAACCCACTGATGTCTTCACTACC
TTGGAAAAGGCTGGGGTTCACTTGAAGGGTAGAGCCAAAAGGGTCATCATCTTTGCCCCT
TCTGCTGATGCCCCTGTGTTTGTGATGGGCATGAACCATGAGAAGTATGTTAACTTCCTC
AAGATTTGTCAGCAATGCTCCTGCACCGCAAACTGCTTAGACCTTGGGTCAAGGTCATCC
ACAACAACTTTGGCTTTGTGGAGGCACTCATGACCATAGTCCGTGCCATCACTGCTACCC
AGGAGACCGTGGATGGCCCCTCTGAGAAGCTGTGGCGTGATAGCCAAGGGGCTGCCCAGA
ACATCATCCCTCCTTCTACGGGCGCTGCCAAGGCTGTGTGGCAAGGTCATCCCTGACCTG
AATGGGAAGCTT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAEHGKLVINGKAITIFQERDPANIKWGDAGAEYVVESTGVFTTLEKAGAHLKGGAKRVIISAP
SGKVDIV.INDPF.DLNYM..MFQY.STHGKF..TVKAE.GKLVINGK.I.IF.E.DP.NIKW...G.E.VV..T.VFTTLEKAG.HLKG.AKRVII.AP
Retrocopy
SGKVDIVGINDPFTDLNYMPSMFQYESTHGKFNSTVKAESGKLVINGKPISIFSEQDPTNIKWDATGVECVVQPTDVFTTLEKAGVHLKGRAKRVIIFAP


Parental protein
SADAPMFVMGVNHEKYDNSLKIVSNASCTTNC-LAPLAKVIHDHFGIVEGLMTTVHAITATQKTVDGPSGKMWRDGRGAAQNIIPASTGAAKAV-GKVIP
SADAP.FVMG.NHEKY.N.LKI....SCT.NC.L.P..KVIH..FG.VE.LMT.V.AITATQ.TVDGPS.K.WRD..GAAQNIIP.STGAAKAV.GKVIP
Retrocopy
SADAPVFVMGMNHEKYVNFLKICQQCSCTANC/LRPWVKVIHNNFGFVEALMTIVRAITATQETVDGPSEKLWRDSQGAAQNIIPPSTGAAKAV\GKVIP


Parental protein
ELNGKL
.LNGKL
Retrocopy
DLNGKL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide